KEGG   Arthrobacter chlorophenolicus: Achl_2787Help
Entry
Achl_2787         CDS       T00834                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Achl_2787
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_2787
  Lipid metabolism
   00071 Fatty acid degradation
    Achl_2787
  Amino acid metabolism
   00350 Tyrosine metabolism
    Achl_2787
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Achl_2787
   00626 Naphthalene degradation
    Achl_2787
Enzymes [BR:ach01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Achl_2787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3108568..3109590)
Genome map
AA seq 340 aa AA seqDB search
MTTTMQAAVVNTFGTDLQVQELPIPTPGPGEALVKVLTTGVCHTDLHAAEGDWPVKPTPP
FVPGHEGVGEVVALGEGVTDLAVGDMVGNAWLWSACGDCQYCRTGWETLCEAQKNGGYSV
DGSFGEYMLVNTRYAARIPAGSDPVEVAPVLCAGVTVYKGLKMTEAQPGQWVTISGIGGL
GHIAVQYAVAMGLRVAAVDIADDKLALAKAHGAALTVNALHEDPAEVIQRETGGCHGVLV
TAVHPSAFGQAIGMARRGGTIVFNGLPPGDFPAPIFEIVLKGLTVRGSIVGTRQDLEEAL
DFYAQGKIHPTVSVRELSEVNAVFDEMKHAKIDGRVVLRF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacaatgcaagcagcagtggtcaacactttcggtaccgacctgcaggtccag
gaactgcccatccctacccccggcccgggggaggccctcgtgaaggtcctcaccaccggc
gtctgccacaccgatctccatgccgcggaaggcgactggcccgtcaagccaacgccgccg
ttcgtgcccggccatgaaggcgtcggtgaggtggtggcactcggcgaaggcgtcaccgac
ctcgccgtcggggacatggtgggcaatgcctggctgtggtccgcctgtggcgattgccag
tattgccgcaccggctgggagaccctgtgcgaggcacaaaagaacggcggctacagcgtg
gacgggtcctttggcgagtacatgcttgtcaacacccggtacgccgcccgcataccggcg
ggatccgaccccgtcgaggtggcgccggtgctctgcgccggcgtcaccgtctacaagggc
ctgaagatgacggaggcgcagcccggccagtgggtcaccatctccgggatcggcgggctg
ggacatattgccgtgcagtacgccgttgccatgggcctccgggtggcagccgtcgacatc
gccgatgacaagctcgccctggccaaggcccacggtgcggccctgacggtcaatgccctg
cacgaagatccggcggaggtgatccagcgcgagacaggaggttgccatggagtgctggtt
accgcggtgcacccttcagcgttcgggcaggccatcggtatggcccgccgcggcggcacc
attgtgttcaacgggctgccgccgggcgacttcccggcgccgatcttcgagattgtgctc
aagggcctgaccgtccgcggttccatcgtgggtacccggcaggacctggaggaggccctg
gacttctacgcccaggggaagatccaccctaccgtctcagtccgggaactgtccgaggtc
aacgcggtcttcgatgagatgaagcacgccaagatcgacggccgcgtggtcctgaggttc
tga

DBGET integrated database retrieval system