KEGG   Arthrobacter chlorophenolicus: Achl_2793Help
Entry
Achl_2793         CDS       T00834                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ach  Arthrobacter chlorophenolicus
Brite
Enzymes [BR:ach01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Achl_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3116507..3118192)
Genome map
AA seq 561 aa AA seqDB search
MAWRPRAVIVLASGVLLALAGCTPDNPEPDMVVNLIQQDWQHTPGVTPDGGGLRVAATSR
SIVEQDGGGGQPNPPVNLAGTHLVATGDFTLSASFTDVTADASLTVYDSPPVIADEFRIE
PAGLRLTLRGDDLDIAVFDGSRQKSVTNPQPAHDERVRLQDPGAELTVHRSGDTLKVASG
GKIVLSQPLRGIFGSGQLWLGLASDAGSFQVSSLTATAPGGASLSTAGPAVEQASQLPDG
LQALAARIRPDFRIGAAVALGPLASDADYGRVLVGNFGAITPENAMKAQNLSPQQGAYTF
EEADAILAVAESKGMAVHGHTIAFTEAMPRWMQELPAGTEAERSASARALRDYVTAVVTH
FRGRLDSLDVVNEPFDTDQGTGLQQNIWYRVFGPAYPAAVSQAVYAADPQVKQFINENGA
DVPGRRQDALLKLALDTNAVGGHIYGVGLQAHVYDLETDAIPAGDLTSTLRNFQDAGLHV
RISENDVADDDGTDVQAEQYATVLDICLRSSACVSYTTWGVDNRYDWLIDDDGSLQQGHD
YLFENGKPTPPYDAIRKVLGG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgcccgcgcgcagtgatcgtgctggcgtccggcgtcctgctcgcccttgcc
ggctgcacgccggacaacccggagcctgacatggtggtcaacctgatccagcaggactgg
cagcatacgcccggggtgacgcccgacggcggcgggttgcgggtggcggcaacgtcacgg
agcatcgtggaacaggacggcgggggaggccagccgaacccgccggtcaacctggccgga
acccacctcgtggccacgggagacttcaccctcagcgcatcgttcaccgacgtgacagcc
gatgcctccctgacggtctatgacagcccgccggtgattgccgacgagttccggattgaa
cccgcgggactgcggctcactctgcgcggcgatgacctggatattgcggtctttgacgga
tcacggcaaaagtccgtgaccaatccccagccggcacatgatgagcgcgtccggctccag
gaccccggggccgaactgacggtgcaccggtcaggggacaccctgaaggtggccagcgga
ggaaaaattgtgctgtcacagccccttcgcggcatcttcggctccgggcagttgtggctg
ggactcgcgagcgacgccggctcgttccaggtcagttccctcaccgccacagctccgggc
ggtgcctcactcagtactgccggccccgccgtcgagcaggcaagccagctgcccgatggc
ctgcaggccctggcggcgcggatccggccggacttcaggatcggtgccgctgtggcactt
ggcccgctggcctcggacgccgactacgggcgggtgctcgtaggaaatttcggtgccatc
accccggagaacgccatgaaggcgcagaacctgtcaccgcagcagggcgcctacaccttc
gaagaggcggacgcgatccttgcggtcgccgaaagcaagggcatggccgtgcacggccac
accatcgccttcacggaagcaatgccccgttggatgcaggaacttcccgcgggcaccgaa
gcggagcgcagcgccagcgcgcgggccttgcgcgactacgtcaccgccgtcgtgacgcac
ttccggggccggctcgattccctggacgttgtcaacgagcccttcgacaccgaccagggc
acaggcctgcagcagaacatctggtaccgcgtcttcggaccggcctacccggccgccgtt
tcgcaggccgtctacgcggccgatccgcaggtgaagcagttcatcaacgagaacggggcg
gacgttccggggcgccgccaggacgccctgctcaagctcgccctggacacgaatgcggtg
ggcgggcacatctacggcgtgggcctccaggcccatgtctacgacctcgaaaccgacgcg
atcccggccggcgacctcaccagtacactgcggaacttccaggacgccgggctgcacgtc
cgcatctcggaaaacgacgtggcggacgacgacggcacagacgtccaggccgagcagtac
gccaccgtcctggacatctgcctgcgctccagcgcctgcgtctcctacaccacctggggc
gtggataaccgctacgactggctgatcgacgacgacggcagcctgcagcagggccacgac
tacctgttcgaaaacgggaagcccaccccgccgtacgacgcgataaggaaggttctgggc
ggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system