KEGG   Pseudarthrobacter chlorophenolicus: Achl_2903Help
Entry
Achl_2903         CDS       T00834                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00010  Glycolysis / Gluconeogenesis
ach00020  Citrate cycle (TCA cycle)
ach00620  Pyruvate metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
ach01200  Carbon metabolism
Module
ach_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_2903
   00020 Citrate cycle (TCA cycle)
    Achl_2903
   00620 Pyruvate metabolism
    Achl_2903
Enzymes [BR:ach01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Achl_2903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ACL40867
JGI: Achl2903
UniProt: B8HEC2
Position
complement(3242553..3244109)
Genome map
AA seq 518 aa AA seqDB search
MSETRVFLLPDLGEGLTEAELVSWHVAVGDSIEVDQPIAEVETAKSAVEVPSPYAGIVAE
LHGKPGETLDVGMPLISVTPVGSSVPAAPVVEPVETELGEPVVEPDSSVVEPVETKEVAQ
SYREEEKAGSGNVLIGYGTPGGHGVAKRTRARKSSVSVVEPASVVEPVETSGVSTGSTTG
DELALLRTRVPGKLGAVISPLVRRMAREHGVDLGDISGSGDSGLIMRRDVEAAISAPVGV
STGSTTESVVEPVETKPVETPVAEPEVPGSRQARSPEDKDARTGLAISSRTPVRGVRKAV
AANMSRSRSEIPEATVWVDVDATGLLELRAGMKASGAEVPGLLAFIARFVTAGLKKYPEL
NTRIETADDGSQEIVGFDGINLGFAAQTDRGLVVPSVRAAEKLSARELDAEIRRLTDVAR
QGKATPAELGGGTFTLNNYGVFGVDGSAAIINHPEVGILGVGRIIAKPWVVNGELAVRKV
TELTLTFDHRVCDGGTAAGFLRFVADAIENPQTLLADI
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacgcgtgtgttcctgctgccggacctgggcgagggcctgaccgaggccgag
ctggtgtcctggcatgttgccgtgggtgattcaatcgaggtggaccagcccatcgccgag
gtggagaccgccaagtccgccgttgaggtgccttcgccgtacgccgggatcgtggctgag
ctgcacggcaagccgggggagaccctggacgtggggatgccgctgatctcggtgacgccg
gttggttcctcggttcccgccgctccggtggttgagcctgtcgaaaccgagttgggtgag
ccggtggttgagcccgattcttcggtggttgagcccgtcgaaaccaaagaagtggcccag
tcctatagggaagaggagaaggccggatccggaaatgtcctgatcggctacgggacgccg
ggcggccacggggtcgccaagcggacccgcgcacgaaagtcttctgtctcggtggttgag
cctgcctcggtggttgagcctgtcgaaacctccggggtttcgacaggctcaaccaccggt
gacgagctcgcgctccttcgtacccgggtcccaggcaaactgggtgccgtcatttcgccg
ctggtccgtcggatggcgcgggagcacggggtggatctgggggacatctccggttccggt
gacagcggcctgatcatgcgccgtgatgtcgaggcggccatctccgccccggtcggggtt
tcgacaggctcaaccaccgaatcggtggttgagcctgtcgaaaccaagcctgtcgaaacc
cccgtggctgagcctgaggttcctggatctcgacaggctcgatcaccggaggataaggat
gcccgcactggactcgctatttcgtcccgcacgccggtccgcggcgtgcgcaaggcagtg
gcggcaaacatgtcccgcagccggtcggaaatccccgaggcaacggtgtgggtggacgtc
gacgccaccggactgctggagctccgtgccggtatgaaggccagtggtgccgaggttccg
ggacttctggcattcatcgcccgttttgtcacagccgggctaaaaaagtacccggagctg
aacacccggatcgaaacggcggacgacgggtcgcaggagatcgtcgggttcgacggcatc
aacctgggcttcgccgcgcagaccgaccggggtctggtggtcccgtccgtccgtgccgcc
gagaagctgagcgcccgtgaactggacgcggagatccggcggctgaccgacgtcgcacgc
cagggcaaggcaacccccgcggaactgggcggcggcactttcactctgaacaattacggc
gtgttcggcgtggacggttccgcggcgatcatcaaccacccggaggtcggcatcctgggc
gtgggccggatcatcgccaagccgtgggtggtcaacggcgaactggcagtccgcaaggtc
accgaactgaccctgacctttgaccaccgggtctgcgacggcggcaccgctgcgggcttc
ctccgtttcgtggccgacgcaatcgaaaacccgcagaccctcctggcggacatctaa

DBGET integrated database retrieval system