KEGG   Arthrobacter chlorophenolicus: Achl_3035Help
Entry
Achl_3035         CDS       T00834                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ach00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ach00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ach02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3376782..3378461
Genome map
AA seq 559 aa AA seqDB search
MTDISRRTIVKGSVLAAALASAPAAANATTPTGSPAGVALVRNRLTLPSGIATGDVTSDS
AVLWSRSSEAGRMTAVLRAVDDGGAVLRGRGAFERVIRGPRATQASDFTAKIHAGNLPSN
TRFALEISFEDDGGSAGESARGTFRTAPDRGAANGKGRTGDTSSGGDVPASYAQSFVWTG
DTAGQGWGINEQIGGMRGYRAMHQTRPDFFIHSGDTVYADGPLTETVVEKDGQVWRNLVT
EEVSKVAETLTEYRGRHRYNMMDANMRAMFADVPVIANWDDHETTNNWYPGEILDDPRYT
VRDVNTLAARGRQAWQENMPIADSSALWRPGTFDDAGQYQPARIYRKISRGPQLDIFCLD
MRTFKSPNTDGKEAYTNNILGQEQVDWLIREVSKSKATWKVIAADLPLGIIVPDGAVNQE
SLANRDNGAPLGRELEIAGVLSAFKKNRVKNAVWLTADVHYCAAHHYSPEGAAFTDFDPF
WEFVAGPIAAGSFGPNAMDGTFGPEVVFSKAGRFAGESPRDGENQFFGHVQLGEDNSFTV
SLRNANGATVFSKVLMPER
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatctcccgccgcaccatcgtcaaaggctcagtgctcgccgccgcgctggcc
tccgccccggccgccgccaacgcaacaactcctaccgggtcccccgccggcgtggccctg
gtccgcaaccggctcacgctccccagcggcatcgccaccggcgacgtcacctccgattcg
gccgtcctctggtcccggtcctcggaggccggccgcatgacggcggtactgcgggcagtg
gacgacggcggcgcggtcctccgcgggcgcggcgccttcgagcgggtcatccgcgggccc
cgggccacccaggcgtccgacttcaccgccaagatccacgccggcaacctcccctccaac
acccgcttcgccctggagatcagcttcgaggacgacggcggatcggccggcgaatccgcc
cgcggcaccttccgcacggcaccggacaggggcgccgccaacggcaagggacgcaccggt
gacacaagcagcggaggcgacgtcccggcgtcgtacgcgcaaagcttcgtctggaccggc
gacaccgccggccagggctggggcatcaatgaacagatcggcgggatgcgaggctaccgg
gccatgcaccagacccggccggacttcttcatccactccggcgacaccgtgtacgcggac
ggcccgctcaccgagacagtggtggagaaggacgggcaggtgtggcggaacctcgtcacc
gaagaagtgtccaaggtggccgaaacgctcaccgaataccgcggccggcaccgctacaac
atgatggacgccaacatgcgcgccatgttcgccgacgtgccggtgatcgccaactgggac
gaccacgagaccaccaacaactggtacccgggcgaaatcctggacgatccccgctacacc
gtccgggacgtcaacaccctcgcggcgcgcggccggcaggcctggcaggagaacatgccc
atcgcggacagcagcgcgctgtggcggccgggaacattcgacgacgccggccagtaccag
ccggcccgcatctaccggaagatctcgcgcggcccgcagctggacatcttctgcctggac
atgcgcaccttcaagtcccccaacacggacggcaaggaggcctacaccaacaacatcctt
ggccaggaacaggtggactggctgatccgcgaggtctccaagtccaaggcaacgtggaag
gtgattgccgcggacctgccgctgggcatcatcgtgccggacggtgccgtcaaccaggaa
agcctggccaaccgcgacaacggcgcgccccttggccgtgagctggaaatcgccggggtg
ctcagcgcgttcaagaagaaccgggtgaagaacgccgtgtggctgaccgccgacgtgcac
tactgcgcggcgcaccactactccccggagggggctgcgttcaccgacttcgacccgttc
tgggaattcgtggccgggcccatcgccgcgggctcgttcggacccaacgccatggatggc
actttcggccccgaggtggtgttttccaaggccggccgcttcgccggcgaatcaccgcgc
gacggcgaaaaccagttcttcgggcacgtccagctcggcgaggacaacagtttcacggtg
agcctgcggaacgccaacggcgccacggtgttctccaaggtgctgatgccggagcggtag

DBGET integrated database retrieval system