KEGG   Arthrobacter chlorophenolicus: Achl_3125Help
Entry
Achl_3125         CDS       T00834                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ach00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3472060..3474075
Genome map
AA seq 671 aa AA seqDB search
MATQEINRPASVWSNVEGLGFGGDYNPEQWPVSVRLEDLELMQEAGVNFLSVGIFSWALL
EPVEGQYDFGWLDEVLDNLAGIGVRVALATATAAPPAWLVRKHPEILPVTADGTVLGPGS
RRHYTPSSAAYRRYATGITRVLAERYKDHPALALWHVDNELGCHISEFYGKEDAAAFRSW
LERRYGSIDALNASWGTAFWSQNYASFEEILPPSVAPSTLNPGQQLDFQRFNSWALMDYY
RELVAVLREVTPEVPCTTNLMASSATKSMDYFSWAKDLDVIANDHYLVAADPERHIELAF
SADLTRGIAGGDPWILMEHSTSAVNWQPRNQPKMPGEMLRNSLAHVARGADAVMFFQWRQ
SFAGSEKFHSAMVPHGGRDTRVWREVVDLGAALKLLEPVRGSRVESRAAIVFDYEAWWAS
EIDSKPSIDVKYLDLLRAFHRSLFLKGVSVDMVHPSAPLEGYDLVLVCTLYAVSDADAGN
IAAAASAGATVLVSYFSGIADPQDHIRLGGYPGAFRDLLGVRVEEFHPLLAGSQLKLDDG
TVASVWSEHVHLAGAEAVQAFTEYPLEGVPALTRRSVGAGAAWYLATFPDSDGIDALVER
LLAESGVSPAAAADTGVELVRRRSADGQRFLFAINHTRSSAAVSATGTDLLTGEPFGGSV
PAGSIAVIREG
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcaggaaattaaccgtccggcaagtgtttggagcaacgtcgaaggcctcggt
ttcggcggcgactacaaccccgaacagtggcccgtgagcgtgcggctggaggacctcgag
ctgatgcaggaagccggcgtgaacttcctgagcgtgggcatcttttcctgggccctgctg
gaaccggttgagggccagtacgatttcggctggcttgatgaggtgctggacaacctcgca
ggcatcggcgtcagggttgccctcgccaccgccaccgccgctcccccggcgtggctggtc
cgcaagcatccggaaatcctgccggtcaccgctgacggaaccgtgctgggaccgggctca
cggcggcactacacgccgtcgtcggccgcctaccggcgctacgccacgggcatcacgcgg
gtcctcgccgaacgatacaaggaccatccggcgctggcgctctggcacgtggacaacgag
ctgggttgccacatttccgagttctacggcaaagaggacgcagccgctttccgcagttgg
ctggaacggcgttacgggagcattgacgccctcaacgcgtcctggggcaccgcgttctgg
agccagaactacgcatcgttcgaagaaatcctgccgccctcagttgcccccagcacgctg
aacccggggcagcagctcgatttccagcgcttcaattcgtgggcgctgatggattactac
cgcgaactcgtggcagtgctccgcgaggtgaccccggaggttccctgcaccaccaacctc
atggcctccagcgccacgaagtccatggactacttcagctgggccaaggatcttgacgtc
atcgccaacgaccactacctcgtggctgccgaccccgaacggcacatcgaactcgcgttc
agcgcggacctgacccggggcattgcgggcggtgacccgtggatcctaatggaacattcg
acgtcggccgtcaactggcaaccccgcaaccagccgaagatgcccggcgaaatgctccgg
aactcgctggcgcacgtggcccgcggcgcggatgccgtgatgttcttccagtggcggcag
agcttcgcggggtccgaaaagttccactccgccatggtgccgcacggcggccgggacacg
cgcgtgtggcgcgaggtggtggacctcggggcggcgctgaagctgctcgaaccggtccgc
ggttcccgggtggagtcccgcgcggccatcgtcttcgattacgaggcgtggtgggccagc
gagatcgattccaagccgagcatcgacgtgaagtacctggacctgctgcgggccttccac
cgttcgctgttcctgaagggcgtttccgtggacatggtccacccgtctgcgccgctcgag
ggctacgacctggtgctcgtctgcacgctctacgccgtatccgacgccgacgccggcaac
atcgccgcggccgcctccgctggcgccaccgtcctggtcagctacttcagcgggatcgcg
gacccgcaggaccacattcggctcggcgggtatccgggcgcattccgggacctccttggc
gtgcgggtggaagagttccacccgctgctggccggatcgcagctgaagctcgacgacggc
accgttgcctcggtctggagcgagcacgtgcacctcgccggcgccgaagcggtccaggcg
ttcacggagtatccgctggaaggcgtcccggccctgacccgccgctccgtgggcgccggc
gctgcctggtacctggccaccttcccggacagcgacggcattgatgcgttggtggaacgg
ctgctcgccgaatcgggcgtctcccccgcggctgccgccgacaccggcgtcgaactggtc
cgtcggcgctcggccgatgggcagcgcttcctgttcgccatcaaccacacccgctcctcc
gccgccgtctcggccacaggaaccgatttgctgaccggggagccctttggcgggtccgtt
ccggcgggcagcattgcggtgatcagggagggctag

DBGET integrated database retrieval system