KEGG   Arthrobacter chlorophenolicus: Achl_3168Help
Entry
Achl_3168         CDS       T00834                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Achl_3168
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_3168
   00620 Pyruvate metabolism
    Achl_3168
   00640 Propanoate metabolism
    Achl_3168
  Energy metabolism
   00680 Methane metabolism
    Achl_3168
Enzymes [BR:ach01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Achl_3168
Lipid biosynthesis proteins [BR:ach01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Achl_3168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3522635..3524647
Genome map
AA seq 670 aa AA seqDB search
MSQDTPSSTATVPAAPAGQGAQQGDAFENLLHETRTFPPTPEFAANAVVKAGEYAEADAD
RPAFWAKQARELLTWSKDFDEALDWSNPPFAKWFVGGEVNAAYNALDRHVENGLGDRVAI
HFEGEPGDSRSYTYAELTEEVKKAANAFESLGVSKGDRVAVYLPMIPEAVITLLACARIG
AVHSVVFGGFSADALRSRIDDAEAKLVVTADGTYRRGKPSALKPAVDDALSQDGHTVQNV
VVVKRNGQDVDWHEGRDHWWDETVGEASAEHTAVGHDSEHPLFILYTSGTTGKPKGILHT
TGGYLTQTAYTHKAVFDLHPETDVYWCTADVGWVTGHSYVTYAPLINGATQVMYEGTPDS
PHQGRWWEIVEKYKVSILYTAPTAIRTFMKWGRDIPDKYDLSSIRVLGSVGEPINPEAWM
WYRTVIGGDNAPIVDTWWQTETGAQMIAPLPGVTAAKPGSAQVPLPGIAVDVVDEMGESV
PDGHGGFLVIREPWPAMLRGIWGDPERFKDTYWSRFETMYFAGDGAKKDEDGDIWLLGRV
DDVMNVSGHRLSTTEIESALVSHPAVAEAAVVGASDETTGQAVVAFVILRGDAANNGDET
VQELRNHVGKEIGPIAKPKNILVVPELPKTRSGKIMRRLLKDVAEGRDPGDATTLADPTI
MQQIAQSLRK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggacactccaagctccacggccaccgttcccgctgccccggcaggacagggt
gcacagcagggcgacgccttcgaaaacctgctgcatgagaccaggaccttcccgcccacg
ccggagttcgcggccaacgcagtggtcaaggccggtgaatatgcagaggccgacgccgac
cggccggctttctgggcgaagcaggcccgcgagctgctcacctggagcaaggacttcgac
gaggctttggactggtccaacccgccgttcgccaagtggttcgtgggcggcgaagtcaac
gccgcgtacaacgcgctggaccggcacgtggaaaacggcctgggcgaccgcgtcgccatc
catttcgaaggcgaacccggtgacagccgcagctacacctacgcggagctgaccgaggaa
gtaaagaaggccgcgaacgcgttcgaatccctcggcgtgtccaagggcgaccgtgtggct
gtttacctgcccatgatccccgaggcggtcatcaccctgcttgcctgcgcacggatcggc
gcggtccactccgtggtgttcggcggcttctccgccgacgccctgcgctcccgcatcgac
gacgctgaagcaaagctggtggtcaccgctgacggaacctaccgccgcggcaagccgagt
gcgctgaagccggctgttgacgacgccctgtcccaagatgggcacaccgtccagaacgtg
gtggtggtcaagcgcaacggccaggacgtggactggcacgagggccgcgaccactggtgg
gacgaaaccgtcggtgaagcgtccgccgagcacaccgccgtcgggcacgactccgagcac
ccgctgttcatcctctacacctccggcaccaccggcaagcccaagggcatcctgcacacc
accggcgggtacctcacccagaccgcgtacacgcacaaggcggtgttcgacctgcacccg
gagacggacgtgtactggtgcacggccgacgtcggctgggtcaccgggcactcctacgtc
acctacgccccgctcatcaacggtgccacccaggtcatgtacgagggcaccccggactcc
ccgcaccagggccgctggtgggagatcgtggaaaagtacaaggtctccatcctgtacacc
gcccccaccgccatccgcacgttcatgaagtggggccgggacatcccggacaagtacgat
ctgtcctccatccgggtcctcggctccgtgggtgagcccatcaaccccgaggcgtggatg
tggtaccggacggtcatcggcggggacaatgcgcccatcgtggacacctggtggcagacc
gaaaccggcgcacagatgatcgccccgcttcccggcgtcaccgcggcgaagccgggctcc
gcgcaggtgccgctaccgggcatcgccgtggacgtcgtggacgaaatgggcgaatcggtg
cccgacgggcacggcgggttcctggtgatccgtgaaccctggccggccatgctccgcggc
atctggggcgatcccgaacggttcaaggacacctactggtcacggttcgagaccatgtac
ttcgccggggacggcgccaagaaggacgaggacggcgacatctggctcctcggccgggtg
gatgacgtcatgaacgtctccgggcaccgcctctccaccacggaaatcgagtccgccctg
gtctcccaccccgccgtggccgaagccgccgtcgttggcgcctctgacgagaccaccggc
caggccgtggtggctttcgtcatcctgcgcggcgacgccgcgaacaacggcgatgaaacc
gtccaggaactccgcaaccacgtgggcaaggagatcggacccatcgccaagcccaagaac
atcctggtggtccctgaactgcccaagacccgctccggcaagatcatgcggcgcctgctc
aaggacgtcgccgagggccgcgacccgggcgacgccaccacactggccgatcccacgatc
atgcagcagatcgcacagtcgctcagaaagtaa

DBGET integrated database retrieval system