KEGG   Arthrobacter chlorophenolicus: Achl_3208Help
Entry
Achl_3208         CDS       T00834                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Achl_3208
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Achl_3208
Enzymes [BR:ach01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Achl_3208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3570528..3571436
Genome map
AA seq 302 aa AA seqDB search
MSSKIILGENQYGKAEVRVVKITRDTNRHEIEDLNVTSQLRGDFSAAHLEGDNAHVVATD
TQKNTIYAFARDGIGSPEAFLLRLGEHFTSSFDWVSGGRWEAESYAWNRIQAHGSEHDHS
FVRNGQEVRTAVLVRDGATSHLISGLKDLTVLKSTESGFVGYPRDRYTTLPETTDRILAT
DVSARWRFKTGTDFSTLDFNKSYEDVKGLLLEGFTEKYSHALQQTLFDMGTKVLEAHSEI
DEIKFSMPNKHHFLVDLSPFGLDNPNEVFFAADRPYGLIEATVQRDDATAAPAAWSGIAG
FC
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaagatcattctcggcgaaaaccagtacggcaaggccgaagtccgcgtcgtc
aagatcaccagggacaccaaccgccacgagatcgaagacctgaacgtcacctcgcagctg
cgcggcgacttctccgcggcccacctggaaggcgacaacgcccacgtggtggccacggac
acccagaagaacaccatttacgccttcgcccgcgacggcatcggctcaccggaagcgttc
ctgctgcgcctcggcgagcacttcacctccagcttcgactgggtcagcggcggccgctgg
gaagccgagtcctacgcctggaaccgcatccaggcccacggcagcgaacacgaccactcg
ttcgtccgcaacggccaggaagtccgcaccgcggtcctggtccgcgacggcgccaccagc
caccttatttcggggctcaaggacctgaccgtcctgaagtccaccgaatcgggcttcgtc
ggctacccccgggaccgctacaccaccctcccggagaccaccgaccgcatcctcgccacg
gacgtctccgcccgctggcgcttcaagaccggcaccgatttcagcacccttgatttcaac
aagagctacgaggacgtcaagggcctcctgctcgaaggattcaccgagaagtactcccac
gccctgcagcagaccctgttcgacatgggcaccaaggtcctggaggcacacagcgagatc
gacgagatcaagttctccatgcccaacaagcaccacttcctggtggacctgtcccccttc
ggactggacaaccccaacgaggtgttcttcgcagcagaccgcccgtacggcctgatcgag
gccaccgtccagcgtgacgacgcaaccgcagcacccgcagcctggtccggcatcgccggc
ttctgctag

DBGET integrated database retrieval system