KEGG   Pseudarthrobacter chlorophenolicus: Achl_3392Help
Entry
Achl_3392         CDS       T00834                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00010  Glycolysis / Gluconeogenesis
ach00052  Galactose metabolism
ach00500  Starch and sucrose metabolism
ach00520  Amino sugar and nucleotide sugar metabolism
ach00521  Streptomycin biosynthesis
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
ach01200  Carbon metabolism
Module
ach_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_3392
   00052 Galactose metabolism
    Achl_3392
   00500 Starch and sucrose metabolism
    Achl_3392
   00520 Amino sugar and nucleotide sugar metabolism
    Achl_3392
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Achl_3392
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Achl_3392
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Achl_3392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACL41349
JGI: Achl3392
UniProt: B8HGT3
Position
3762824..3763813
Genome map
AA seq 329 aa AA seqDB search
MYAIGVDLGGTKTAAGVVSGDGELLFSDTIPTLSRDGSAAILDATASLVAGLVRRADDAG
ITVKRVGVGSAGVIDAARGVVASATDAIAGWAGTALTAGLAARLDLPASSVLAVNDVHAH
ALGEAWTGAAAGTSSSLLVAFGTGVGGSFVLDGAPVLGHRYAGGHVGHFASPYACFDGAP
LPCVCGGAGHVEAIASGPAIREAYVRLGGSAPAADTRAVFGLAGSGDAIAARAIAVAAAA
AGQAVGGLANILDPEVVLVSGGLADAGERWRQPMEAALRAELLPALTGVPVRPAALGNTA
AIVGAARLVLEPADAGCAEFTSALTYRRN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgattggtgttgaccttggcgggaccaagactgctgccggggttgtttccggt
gacggggagttgctgttttcggacaccatccccacgctgagccgtgacggttccgccgcg
atcctcgacgccaccgccagccttgttgccgggctggtccgccgggcggacgacgccggg
atcaccgttaagcgggtcggcgtcggttccgcaggggtcatcgatgccgcgcgcggcgtg
gtggcgtccgcgacggacgccatcgccggctgggccgggacggcactcaccgcaggcctg
gccgcccggctggacctgccggcgtcgtccgtccttgccgtgaacgacgtgcacgcgcac
gccctcggcgaagcgtggacgggtgcggccgccgggacgtccagctcgctgctggtggcg
ttcggcaccggtgttggcgggagcttcgtcctggacggcgcccctgtgctggggcaccgc
tacgccggcgggcatgtggggcacttcgcctcgccgtacgcctgcttcgacggcgccccg
ctcccctgcgtctgcggcggtgccgggcatgtcgaagccatcgcgtccgggccggccatc
cgtgaggcctacgtccgcctgggcggctcagcccccgctgcggacacccgggctgtcttc
ggcctggccggctccggtgatgcgattgcggcccgggccatagccgttgctgctgccgct
gccgggcaggccgttggcggcctggccaacatcctcgaccccgaggtggtgctggtatcc
ggcgggctggccgatgccggcgaacgctggcggcagccgatggaggccgcactgcgcgcc
gaactgttgcccgccctgaccggcgttcccgtgcgtcccgccgcgctgggaaatacggcg
gccattgttggcgccgcccggcttgtccttgaacccgccgatgccggctgtgccgaattc
acttcagccctgacgtaccgaaggaactga

DBGET integrated database retrieval system