KEGG   Arthrobacter chlorophenolicus: Achl_3587Help
Entry
Achl_3587         CDS       T00834                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ach00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3988425..3989810)
Genome map
AA seq 461 aa AA seqDB search
MKDAVIVGGGLAGLSAAWRLRHWDTVVLESGTRVGGRIRSERRGDYWLNWGGHVFAGAGS
STDALLNEVGVMAVQIPGSLQGLSMNGKFIKKGHIATYPFRIPMSLAARVDTMRAGLKVV
SGVAKYTGVVRKRIGESGAMRQQRIYDFENSTSFQDFVGNLSEDAAALFKTTVTRSAGDM
DQISAGAGIGYFSLVLGFGQGLSQGIVGGPSTLTESIAAALGDRIELGAVVQEVVHKKDS
VLVRYRQDGVDREVEARTVVLATTADVSHKIGVDLPEELRGALDQIKYGPHVSTAFLTNE
TTAKPWDDIYAIAAPKRSFAIALNQASIVRGTESVRKPGGSFMTFSPASLGKALLEKPEE
EVINTHLTDLDQVLGHGFAGSVVEAKVDRWKNASPYCFPGRAKIQSTLMRGTDRVFLAGD
YLGTLYTESSITTGFSAAQEAASVLATHRQAPPLSGLSIVA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgcagtaatcgttggcggcggactcgccggcctctcggcggcctggcggctg
aggcactgggacacagtggtcctggaatcgggcacccgggtgggcggacgcatccgttcc
gaacggcgcggtgactactggctgaactggggcgggcacgtcttcgccggcgccggttcc
tccacggatgccctgctcaacgaagtcggcgtgatggccgtccagatccccggttccctg
caggggctgtccatgaacggcaagttcatcaagaagggacacatcgccacctaccccttc
cgcatccccatgtccctggccgcccgcgtcgacaccatgcgtgccggcctgaaggtggtc
agcggagtggccaagtacaccggcgtggtgcgcaagcgcatcggcgaatcaggtgccatg
cgccagcagcggatctacgacttcgagaacagcacctccttccaggacttcgtgggcaac
ctgtccgaggacgccgccgccctgttcaagaccacagtgacccggtccgccggtgacatg
gaccagatctccgccggcgccggcatcggctacttcagcctggtcctcggtttcggccag
gggctcagccagggcatcgtgggcggaccgtccaccctgaccgaatccattgccgcggca
ctgggcgaccgcattgagctcggcgcggtggtgcaggaagtagtccacaaaaaggattcc
gtgctggtccggtaccgccaggacggcgtcgaccgcgaagtggaggcccgcaccgtggtc
ctggccaccactgccgacgtctcgcacaagatcggcgtggacctgcccgaggagcttcgc
ggggcgctggaccagatcaagtacggtccgcacgtcagcaccgccttcctcacgaacgaa
accaccgcaaagccgtgggatgacatctacgccatcgccgcccccaagcgctccttcgcg
attgccctaaaccaggcgagcatcgtgcgcggcaccgaatccgtccgcaagcccggcggc
agcttcatgaccttctcacccgccagcctcggcaaggccctgctggagaagcccgaggag
gaggtcatcaacacccacctgaccgatttggaccaggtccttggccacggcttcgcgggc
agtgtggtggaggccaaggtggaccggtggaagaacgcctcaccgtattgcttcccgggc
cgggcaaagatccagtccaccctgatgcgcggaaccgaccgcgtcttcctggccggcgac
tacctgggcaccctgtacaccgaaagctccatcaccaccggcttctccgcagcccaggag
gctgccagcgtcctggcaacgcaccggcaggcaccgccgctctccggcctgtccatcgtc
gcctga

DBGET integrated database retrieval system