KEGG   Arthrobacter chlorophenolicus: Achl_3647Help
Entry
Achl_3647         CDS       T00834                                 

Definition
XRE family transcriptional regulator
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Achl_3647
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Achl_3647
Enzymes [BR:ach01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Achl_3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4054315..4055838)
Genome map
AA seq 507 aa AA seqDB search
MTQETAEHVAVMLRNARSEKGWTQGQLAAELGTSQSAVARMEQGKQNLSLKMIQRLEAIF
DRSIVNVGKPQMTHLRVEGGRTLSGAVDVNSSKNAGVALLCASLINRGTTVLRRLARIEE
VNRIVEVLTSIGVECTWLNATDLRLRRPAVLDLDSMDVEAARRTRSVIMLLGPLLDESAE
YRLPYAGGCDLGTRTVEPHMQALRQFGLSVEATAGFYAVQAPAADSHDRSFVLTERGDTV
TENAIMAAAHREGTTVIRNASPNYMVQDLCFYLQMLGVTIEGVGTTTLRITGKPVINADI
EYFPSEDPIEAMSLITAGIVTNSEVTVRRVPIEFMEIELATLGQMGQQLEISGEYMARNG
RTRLVDVTTKPSELKAPEDKIHPMPFPGLNIDNLPFFAVIAANATGQTMIHDWVYENRAI
YLTELNRLGAQVQLLDPHRIYINGPTKWRAAEVGCPPALRPAACLLLAMLAARGVSELRN
IYVIERGYEDLAERLNTIGARIEYFQG
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggaaaccgctgaacacgttgccgtcatgctcaggaacgcccggagcgagaaa
ggctggacccagggccagctggccgccgagctgggtaccagccaaagtgccgtggcccgg
atggaacagggtaaacagaacctgagcctgaagatgatccagcgccttgaggccatcttc
gaccggagcatcgtcaacgtgggcaagccgcagatgacgcaccttcgcgtggagggcggc
cgcaccctgtccggcgcggttgatgtcaacagcagcaagaacgccggcgttgccctgctg
tgcgccagcctcattaaccgcggcaccaccgtcctgcgccgcttggcccggatcgaagag
gtcaaccgcatcgtagaggtgctgaccagcatcggagtggaatgcacctggctcaacgcc
acggacctccgcctgcgccggcccgctgtcctggacctcgactctatggacgtggaagct
gcccgccgcacccgcagcgtcatcatgctgttgggccccctgctggacgagtcagccgag
tacaggcttccctacgcgggtggctgcgacctcggcacccgcactgttgagccgcacatg
caggccctgcgccagttcggcctgtccgtggaagccacggccggtttctacgccgtccag
gccccggcggcggactcacatgaccgctccttcgtcctcaccgagcgcggcgataccgtc
acggaaaacgccatcatggcggccgcccaccgtgagggcaccacggtcatccggaacgcc
agccccaattacatggtgcaggatctctgcttctacctgcagatgctgggcgtcaccatc
gagggcgtgggcaccaccacgctgaggatcaccggcaagcccgtcatcaacgccgacatc
gagtacttcccgtccgaagaccccatcgaggccatgagcctgatcaccgcgggcatcgtg
acgaactccgaggtcacggtccgccgggtgcccatcgagttcatggagatcgagctggcc
acgctggggcagatgggccagcagctggaaatttccggcgaatacatggcacggaacggc
cggacccggctggtggacgtgaccaccaagccctcggagctgaaggccccggaggacaag
atccaccccatgccgttccccggcctcaacatcgacaacctgccattcttcgccgtgatc
gccgcaaacgccaccggccagacgatgatccacgactgggtgtacgagaaccgcgccatc
tacctgacggagctgaaccggctcggcgcgcaggtccagctcctcgatccccaccggatc
tacatcaacggccccaccaagtggcgcgccgccgaggtgggttgcccgccggccctgcgt
ccggccgcgtgcctgctgctggccatgctcgcggcacgcggcgtctccgagctgcgcaac
atctacgtgatcgagcgcggctatgaggacctggccgagcggctgaacaccatcggcgcc
aggattgagtacttccagggctga

DBGET integrated database retrieval system