KEGG   Arthrobacter chlorophenolicus: Achl_3691Help
Entry
Achl_3691         CDS       T00834                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ach01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:ach00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ach00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4108701..4109912
Genome map
AA seq 403 aa AA seqDB search
MSGNKAVAYKEPGVVEIIDTPYPTFELQAGPGVNPINVGRKVPHGVILRTVSTNICGSDQ
HMVRGRTTAPAGLVLGHEITGEVIEAGPDVEFIKVGDIVSVPFNISCGRCRNCKERKTGI
CLNVNPDRPGSAYGYVDMGGWVGGQAEYVLVPYADWNLLRFPDRDQALEKIMDLTMLSDI
LPTGFHGAVTAGVGVGSTVYVAGAGPVGLAAAASAQLLGAAVVIVGDLNEDRLAQARSFG
CETVNVANGDPADQIEQILGVREVDSGIDAVGFEARGHGHGAQEAPATVLNSLMDLTTAG
GSVGIPGLYVTGDPGATDEAAKKGSLSLSLGTGWAKSLSFATGQCPVMKYNRQLMMAILH
DRIHIAKAVNATAIPLEDAPRGYAEFDAGAATKYVLNPNGYLN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtaacaaagccgttgcgtacaaggagcccggggtcgtcgaaatcatcgacacc
ccctaccccacctttgaactgcaggccggccccggcgtcaaccccatcaacgttggccgg
aaggtcccgcacggggtcatcctgcgcaccgtgagcaccaacatctgcggctcggaccag
cacatggtccgcggccgcaccaccgccccggccggcctcgtgctggggcacgaaatcacc
ggtgaagtcattgaggccgggccggatgtcgagttcatcaaggtgggggacattgtctca
gtccccttcaacatctcctgcggccgctgccggaactgcaaggaacgcaagaccggaatc
tgcctgaacgtgaacccggaccgtcccggttccgcctatggctacgtggacatgggcggc
tgggtgggcggccaggccgagtacgtgctggtcccctacgccgactggaacctgctgcgg
ttccctgaccgggaccaggcccttgagaagatcatggacctgaccatgctctcggacatc
ctgcccaccggcttccacggcgccgtcaccgcaggcgtgggcgtcggttccaccgtgtac
gttgccggagcgggacctgtgggcctcgccgccgccgccagcgcccagctgctgggtgcc
gcggtggtcatcgtcggtgacctcaacgaggaccgtctggcccaggcccggtccttcggc
tgcgaaactgtcaacgtggccaacggcgatcccgcagaccagatcgaacagatcctcggc
gtccgtgaagtggactccggaatcgacgcggtcggtttcgaagcccgcggacacggacac
ggggcgcaggaagcaccggccacggtactcaattcgctgatggacctcaccaccgccggc
gggtccgtgggcatcccgggcctgtacgtcaccggggacccgggcgccacggacgaggcc
gccaagaagggcagcctgtccctctcgctgggcaccggctgggcaaaatccctctccttc
gccaccggccagtgcccggtgatgaagtacaaccggcagctgatgatggccatcctgcat
gaccggatccacatcgccaaggccgtcaacgccacggccatcccgctggaggacgcaccc
cggggttacgcggagttcgacgccggcgcagccacgaagtacgtcctgaacccgaacggc
tacctcaactaa

DBGET integrated database retrieval system