KEGG   Arthrobacter chlorophenolicus: Achl_3719Help
Entry
Achl_3719         CDS       T00834                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Achl_3719
  Lipid metabolism
   00600 Sphingolipid metabolism
    Achl_3719
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Achl_3719
Enzymes [BR:ach01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Achl_3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4145822..4148836)
Genome map
AA seq 1004 aa AA seqDB search
MPVQSPTTVSNAAASDASDSVPRNLELGAGGVLELSSVAPGRGALAPRAYLASDAPRLSL
NGDWQFRLSPGIRSAPAEGWQLGQDLDGFETLPVPSSWPMHGHGAPAYTNIQFPFAVEPP
HVPEANPIGDHLLTFHAGPEFFPNALLRFDGIDSAGTVWLNGVELGTTRGSRLAHEFDVS
GILTEGSNTLAVRVAQFSAASYVEDQDMWWLPGIFRDVTLQARPADGIDDVFVHADYDAG
TGEGVLRVEASRGGKAIDAVVRVPELDLELKAGQEHRLPSVAPWSAEEPRLYEATVSTPA
ETVSLQLGFRSITIEDSQFKVNGRRILLRGVNRHEHHPRLGRVVPQEVMEAELKLMKQHN
INAIRTSHYPPHPKFLALADQLGFYVVLECDLETHGFESAGWAQNPSDDPQWEDALLDRM
RRTVERDKNHAAVVMWSLGNESGTGRNLAAMSRWTKDRDPSRPIHYEGDWSSPYVDVYSR
MYANQAETALIGQGTEPPLDDPELDARRRAMPFVLCEYVHAMGNGPGGMTEYQELFERHP
RLMGGFVWEWLEHGIAVPTPGGGEHFAYGGDFGEEIHDGNFVTDGLVDANRQPRPGLLDF
KRVVAPLRIQVAGDWSGFTVHNGHDFTDTSPFSFQYTVEADGDTIDGGTVEVPRVAPQSA
ATVALPAGLPHTDGPAVLTVSAVLTAATSWAGTGHEIAWGQSVRGVARVEEPRAAESVAA
TDDELRLGPAVFSRLTGMPTRIGGISVAKLGLSLWWPPTDNDLGREWGGADLRPLATQWK
DAGLDRLHTRLLGISAERTDDGGERLVTRTRVGAADKQFGVLVDYTWTSDGESLALRTQV
RPQGSWVNAGFEVEWARIGLELVLDGGTSAVSWFGQGPHQAYPDTGQGTRTGWFSMPLGD
LDVEYARPQESGARAGVRSAALEVDGATLDIAGEPFALTVRPYSQAALNEATHRPDLAAD
GRTYIYLDNAMRGVGTGACGPGVLDPYRLQPRDADFTVVLRVRP
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtccagtcccccacaacggtgtcgaatgctgctgcaagtgatgcctccgactct
gtgccgcgcaatcttgaactcggcgcaggaggcgttctcgagctctcctcagtggctccg
gggcggggtgcgcttgctccccgggcctatctcgccagcgatgcgccgcggctgtccctg
aacggcgactggcagttccgcctcagcccgggcatccgcagcgcccccgccgaggggtgg
cagctgggccaggatctggacggcttcgaaaccctgcccgttccgtccagctggcccatg
cacgggcacggcgcaccggcgtacaccaacatccagtttccgtttgccgtggaacccccg
catgtgccggaagccaaccctattggtgaccacctcctgacgttccacgccggcccggag
ttcttccccaacgcactgctgcgtttcgacggcatcgactccgccggcacggtgtggctg
aacggcgtcgaactcggcaccacccgcggcagccgccttgcccacgaattcgacgtctca
ggaatccttacggaaggcagcaacaccctcgccgtgcgggtggcgcagttctcggccgcc
agctacgtggaggaccaggacatgtggtggctcccggggatcttccgggacgtcaccctt
caagcccgccctgcggacggcatagacgacgtcttcgtccacgctgactacgacgccggc
acaggcgaaggtgtgctgcgcgtggaggcgagccggggcggaaaagcgattgacgccgtc
gtacgcgttcccgaactggacctggagcttaaggccggccaggagcaccgcctgccatcc
gtagcgccgtggtcggcagaggagccccgcctgtacgaagccacggtcagcaccccggcc
gaaacggtgtccttgcagctgggattccgcagcatcaccatcgaagactcccagttcaag
gtgaacgggcggcggatcctgctgcgcggggtgaaccgccacgagcaccatccccggctg
gggcgcgtggttccgcaggaggtgatggaggcggagctcaagctcatgaagcagcacaac
atcaacgcaatccgcacatcgcactacccgccccacccaaaattccttgccctggctgac
cagcttggtttctacgtcgtgctcgagtgcgacctggaaacgcacgggttcgagagcgcc
ggctgggcccagaacccgagcgatgatccccaatgggaggacgccctgctggaccggatg
cgccggacggtggagcgggacaagaaccatgcagccgtcgtgatgtggtcgctgggcaac
gaatccgggaccggccggaacctggccgcgatgtcgcgctggaccaaggaccgcgacccg
tcccgccccatccactacgagggtgactggtcctcaccctacgttgacgtgtactcccgc
atgtacgccaaccaggccgagactgcactgattggacagggaactgagcctccactcgat
gaccccgagctggatgcccggcgccgtgccatgcccttcgtgctgtgcgaatatgttcac
gccatgggcaatggcccgggaggaatgaccgagtaccaggaactctttgaacgccacccc
aggctgatgggcggcttcgtctgggagtggctggaacacggaatcgccgtccccacgccg
ggtggcggtgagcacttcgcctatggcggtgatttcggtgaggaaattcacgacggcaac
ttcgtcaccgacggactggtggacgccaatcgccaaccccggcccggcctcctcgacttc
aagcgcgtcgtggcgccgctgcggatccaggttgccggggactggtccggcttcaccgtc
cacaacggacacgatttcaccgacacgtccccgttcagcttccagtacacggtggaggcc
gacggcgacactatcgacggcggcacggtggaggttccgcgcgtcgcgccgcagtccgcg
gccacagttgcgttgcccgccggccttccgcacacggacgggccggcagtcctcaccgtc
agcgccgttctcaccgctgcgacgtcctgggccggcaccggccacgagatcgcctggggc
cagtccgtccgtggcgtcgcgcgtgttgaagagccccgcgctgctgaatccgtggccgcc
actgacgatgagctgcggctgggcccggcggtgttcagcaggctgacggggatgcccaca
cgcataggcggcatcagtgtggcaaagctggggctctcgctgtggtggccccccaccgac
aatgacctgggcagggaatggggcggcgccgacctccggcccctggccacccaatggaag
gatgcagggcttgaccggctccatacccggctgcttggcattagcgctgaacgcaccgac
gatggcggggagcggctcgtcacgaggaccagggtgggtgccgcggacaaacagttcggg
gtccttgtggactacacgtggaccagtgacggggaatcgctggcgctccgaacccaggtc
cggccgcagggatcctgggtcaacgccggatttgaggtggagtgggcccggatcggcctg
gaactggtgctggacggcgggacgtcagcggtgagctggttcgggcagggaccgcaccag
gcttatccggatacggggcaaggcacgcggacgggatggttttccatgcccttgggtgac
ctcgatgttgagtatgcgcggccccaggagtccggtgcccgcgccggtgtccgctcggct
gcccttgaggtggatggcgccacgttggacatcgccggcgagccctttgccctgacggta
cgcccctacagccaggccgcactcaacgaagcaacccaccggcctgacctggcagccgac
gggcggacctacatctacctcgacaacgccatgcgtggtgtgggcaccggagcctgcggt
ccgggtgtcctcgatccgtaccgcctgcagccacgggatgccgacttcacggtagtgctg
cgggtccgtccgtag

DBGET integrated database retrieval system