KEGG   Arthrobacter chlorophenolicus: Achl_3820Help
Entry
Achl_3820         CDS       T00834                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Achl_3820
   00500 Starch and sucrose metabolism
    Achl_3820
Enzymes [BR:ach01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Achl_3820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4263886..4265769)
Genome map
AA seq 627 aa AA seqDB search
MRRFTPSRRTVLASAATGALTAAAVLAGAAPAAHAAGGPARAQSNRKPVIFVVGDSTSSA
YQRSERPRAGWGQALPLLLGPQATVFDYAWSGASSKSYADAGLLGEVAEALQPGDYLLIS
FGHNDEKVEDPSRGTDPQTTFKEYLGRYLDAASAAGAKAVLVTPVERRRFSALGVAQDTH
GAYPQAIKELAASRGVPLVDLTASSKELWQKLGPEGTTSHFLHATPGQYPQYPNGVTDNT
HFQAQGALAVAQLVVAGLQAQPAAPPGWFREPGGTLDPLSAIYWPSERPVDKPLVLTVGN
GGQFSTVQAAVDAAPANSTRRTEIRIAPGTYRELIRVPANKPRVSFIGRGQAPEDVVLVY
NNASGTPKPDGTGTYGTGGSTSVRIDGPDFTAVNLTFSNDFDEAANPDMKNRQAVALFLA
GDRAVLRNIRCLGNQDTLLVDSPARGVEARSYFTDSYVEGDVDFIFGRGTAVFSGCRIRS
LDRGSSTNNGYVSAGSVNIGIKHGYLFTQCRFVSDAAAGSVHLGRPWHPSGDPEAIAQVL
VRDSWLGAHISGTPWTDMSGFSWQEARFHEFNNNGPGSRATPDRPQLDPRLAEEFTAGAY
LHGADAWAPQLAGSKADSTALSVGQPA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgattcacgcccagccggcgcaccgtgctcgcttcggctgcaaccggcgccctt
accgctgcggcagtcctggccggagcagccccggccgcgcacgcagccggcggccccgcc
cgggcgcagtccaacaggaaaccggtgatcttcgtagtgggggattccacctcctccgcc
taccagcgctcggaacgtccccgcgccggctggggccaggccctgccgctgctgctcggg
ccgcaggcgacggtgttcgactacgcctggtccggcgcctcctcgaaaagctatgccgac
gccggcctgctgggcgaggtggcggaggcgctgcaaccgggcgactacctgctcatctcc
ttcggccacaacgacgaaaaagtcgaggatccgtcacgcggcaccgatccgcaaaccacg
ttcaaggagtacctgggccggtacctcgacgccgcatcagccgcaggcgccaaagccgtc
ctggtcacccccgtggaacggcgccgcttcagcgccctcggcgttgcccaggacacccac
ggcgcctacccccaggcgatcaaggagctcgctgcgtcccgcggtgttcccctggttgac
ctgacggcatcctccaaggagctctggcaaaagctggggccggagggaaccacctcgcac
ttcctgcatgccactcccggccagtacccgcagtaccccaacggcgtcacggacaacacc
cacttccaggcgcagggcgccttggccgtggcacagcttgttgtcgcaggactgcaggcg
cagccggccgcaccgccgggatggttccgggagcccggcgggacgctggacccgctctca
gccatctactggcccagcgaacgcccggtggacaagcccctggtcctcaccgtgggaaac
ggcgggcagttctccaccgtccaggccgccgtcgacgcagcaccggcaaacagcacccgc
cgtacggaaatcaggatcgcgcccgggacgtaccgcgagctgatccgggtaccggccaac
aaaccgagggtgtcgttcatcggacgcgggcaggcgccggaggacgtggtgctggtctac
aacaatgcgtccggcaccccgaaacccgacggcacggggacctatggcaccggcgggagc
accagcgtgcggatcgacggcccggatttcacggcagtgaacctgacgttcagcaacgac
ttcgacgaagccgctaatccggacatgaagaaccggcaggccgtggcactgttcctggcc
ggggaccgggctgtcctccgcaatatccgctgcctgggcaaccaggacacactgctggtg
gattcccccgcccgcggtgtggaggcacgctcctacttcacggactcctacgttgaaggc
gacgtggatttcatcttcggccggggaactgccgtgttctccggctgccggatccgctcc
ctggaccgcgggtccagcaccaacaacggatacgtctccgccggcagcgtcaatatcggg
atcaagcacggatacctgttcacccagtgccgcttcgtctcggatgcagcggccggatcc
gtccatctcggccggccatggcatcccagtggagatccggaggccattgcccaggtgctg
gtccgcgactcgtggctgggagcgcacatctccggaacgccgtggacggacatgagcggt
ttttcgtggcaggaggccagattccacgagttcaacaacaatggccccggatcacgggca
acccctgaccggccgcaactggatccccgccttgcagaggagttcactgctggagcgtac
ctgcacggggcagatgcctgggcgccccagctggccggaagcaaggccgacagtaccgcc
ctgagcgtcggccagcccgcgtaa

DBGET integrated database retrieval system