KEGG   Acinetobacter sp. ADP1: ACIAD0080Help
Entry
ACIAD0080         CDS       T00185                                 

Gene name
rmlC
Definition
dTDP-4-keto-6-deoxy-D-glucose-3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:aci00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:aci00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
75737..76300
Genome map
AA seq 187 aa AA seqDB search
MNIIETKIKDLLIFEPRVFGDDRGWFMESFNQQVFEQALTERGLDIPKFVQDNHSFSKKG
VLRGLHYQLNPHAQGKLVRVVQGRAWDVAVDIRENSSTFGEWVGVELTADNHKQFWIPAG
FAHGFIALEDNTQFLYKTTDYYSKECERSIVWNDETINIEWPIEKDLEILLTDKDRLAPQ
LIQADKF
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatattattgaaactaaaatcaaagatttactcatctttgaaccacgggtatttggt
gatgatcgtggctggtttatggaaagctttaatcagcaagtatttgagcaggcattgact
gaacgtggtttggatatacctaagtttgttcaggacaatcattccttttctaaaaaaggg
gtacttcgtggattgcactatcagctcaacccgcatgctcaaggcaaattggtgcgggta
gtacaaggtcgagcgtgggatgttgcagtagatattcgtgaaaattcatctacatttggt
gaatgggtcggagttgaactgacggcagataaccataaacagttttggattccagcaggg
tttgcacatggctttattgctttagaagataatactcagtttttatacaagacgacagat
tattactctaaagaatgtgagcgatccattgtatggaatgatgaaacgattaatattgaa
tggcctattgaaaaagacctagaaattcttttgaccgataaagatcgtttagcaccacaa
ctgattcaagctgataaattttaa

DBGET integrated database retrieval system