KEGG   Acinetobacter sp. ADP1: ACIAD0099Help
Entry
ACIAD0099         CDS       T00185                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACIAD0099 (galU)
   00052 Galactose metabolism
    ACIAD0099 (galU)
   00500 Starch and sucrose metabolism
    ACIAD0099 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ACIAD0099 (galU)
Enzymes [BR:aci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ACIAD0099 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
96123..97010
Genome map
AA seq 295 aa AA seqDB search
MVDKMIKKAILPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGITQIILVTH
SSKASIENYFDRNFELETTLEQKKKHDLLAEISNIVPAGVTIVSVRQPQPLGLGHAVLCA
KDVVGDDDFAVLLPDVLVKAKQATHDLTQMIARFDAAQAAQIMVEAVPDHLVDQYGIVDV
AQIPAEGQSEVMKGIVEKPKQDQAPSNLSVVGRYILPAKIMQLLEQTPKGAGNEIQLTDA
IALLQKTNVVEAYRMQGQTFDCGSKLGYLKAVLHYGLEHPKLGHDFKQLINELDL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggttgataaaatgatcaaaaaagcaattcttccagtcgcaggtttaggaacgcgcttt
ttaccagcaagtaagtcaattcccaaagaaatggtcactgtcgtggaccgcccagcgatc
gaatatgtggtgcgtgaagccgtcgaagcgggaattacccaaattattctggtgacacat
tcttcaaaggcatcaattgaaaattatttcgatcgaaattttgagctggaaaccacactt
gaacaaaagaaaaagcatgatttgttggccgagattagcaatattgtacccgcaggtgtc
accattgtcagcgtacgtcaaccacagcctttaggtttaggacatgcggttctctgtgcc
aaagatgtggtgggtgatgacgattttgcagtactactacccgatgtattggtcaaggca
aagcaagcaactcatgatcttacccaaatgattgcacgctttgatgctgctcaggctgca
cagattatggtcgaggctgtacctgatcatctggtggatcaatacgggattgtagacgtt
gctcaaattcctgccgaaggtcagagtgaagtgatgaagggaattgtagaaaaaccgaaa
caggatcaggcaccttctaatctttcagtggttgggcgctatattttaccagcaaaaatt
atgcaactgcttgaacaaacacctaagggtgcaggaaatgaaattcagctcacagatgcg
attgccttactccaaaagacaaatgtggtagaagcttaccgtatgcaaggtcagacattt
gattgtgggagtaagctcggttatttgaaagctgtgttacattatggattagaacaccca
aaattgggtcatgattttaaacaattgattaacgaactcgatttataa

DBGET integrated database retrieval system