KEGG   Acinetobacter sp. ADP1: ACIAD0191Help
Entry
ACIAD0191         CDS       T00185                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aci00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
186781..187665
Genome map
AA seq 294 aa AA seqDB search
MINFAEVSGITIENLGEHGLKALRISNTFCDALIALQGAQILEFNVKYQSYTQALLWLSE
LNSYQPAKAIRGGIPLCFPWFGGHAEEKSYPSHGFARNLEWALVDVVDIQESGHQLIFEL
TDNALTRAYWDVAFRLQMQIECGTQLRLSLSLVNLDEKQIHYGFAWHSYFPVKIDEAAVY
GLQGKAFIDQLDQHRHKIQHEEAIHFSEEIDRIYPLTQGSFQLRANHRTTLLINSHAQSA
VIWNPWIEKTARLADLKPESWREFVCVESGQIASQQQYLEAGQSVEYTLEISAV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattttgcagaagtatcaggtattacaattgaaaatttaggggaacacggttta
aaggcactacgaatttcgaatacattttgtgatgccttgatcgctttacaaggtgcacaa
attctagagtttaatgtcaagtatcagtcttatacacaagcattactctggctttccgaa
ctcaattcatatcagcccgcaaaagccatacgcggtggcataccgttgtgttttccttgg
tttggtggacatgcagaagaaaaatcatacccttcacatggttttgctagaaatctggag
tgggcactggtcgatgtggttgatatacaagaatcaggtcatcaacttatatttgaattg
acagacaatgctctcaccagagcatattgggatgtcgcttttcgtttacagatgcaaatc
gaatgtggtacacagcttaggctgagtttgtctttagtcaatctcgatgaaaaacagatt
cactatggatttgcctggcacagttattttcctgtcaaaattgatgaggcagcagtgtat
ggtttgcaaggcaaagcgtttatcgatcaactggatcaacatcggcacaagatacaacat
gaagaagccattcatttctctgaagaaatcgaccggatttatccattgacccaaggttcc
ttccagttaagagcaaaccataggacgacgctattgatcaacagtcatgctcagagtgct
gtgatctggaatccttggattgagaaaaccgcacgtttagctgacttaaaacctgaaagc
tggcgagaatttgtatgtgttgaatctgggcagattgcttcacagcagcagtatctcgaa
gcgggtcagtcggttgaatatactttggaaatctcagcagtttaa

DBGET integrated database retrieval system