KEGG   Acinetobacter sp. ADP1: ACIAD0252Help
Entry
ACIAD0252         CDS       T00185                                 

Gene name
holC
Definition
DNA polymerase III chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ACIAD0252 (holC)
   00240 Pyrimidine metabolism
    ACIAD0252 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ACIAD0252 (holC)
   03430 Mismatch repair
    ACIAD0252 (holC)
   03440 Homologous recombination
    ACIAD0252 (holC)
Enzymes [BR:aci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ACIAD0252 (holC)
DNA replication proteins [BR:aci03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ACIAD0252 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(250800..251207)
Genome map
AA seq 135 aa AA seqDB search
MTKISFYLFETSQERQVESACRLCRKLVKQQQKLWWFCPDLELQKQLDERLWTFDRESFI
THGIDQPHAFVCISSHLPTSKEWIVFNFNNQALEQMSEFSHIIEIIENTESAKQIGREKF
KLYRRLGVEPRTFKL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatcagtttctatttatttgaaaccagtcaggaacggcaagtcgaaagtgct
tgccgtttatgccgaaaactcgtgaaacaacaacaaaagctatggtggttttgtccagat
ctggagttacaaaagcagcttgatgaacgtttatggacctttgatcgggaaagttttatc
actcatggtattgatcaacctcacgcttttgtttgtatttcaagccatttacctacctcg
aaagaatggattgtgtttaattttaacaatcaagcacttgaacaaatgagtgagtttagt
cacattattgaaattattgagaatactgaatccgcaaagcagattggacgagaaaaattc
aaactttatcgtcgtttaggtgtagaacctcgtacttttaaattataa

DBGET integrated database retrieval system