KEGG   Acinetobacter sp. ADP1: ACIAD0263Help
Entry
ACIAD0263         CDS       T00185                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACIAD0263 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACIAD0263 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ACIAD0263 (thrC)
Enzymes [BR:aci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ACIAD0263 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(262869..264008)
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVIYDAATDQFTGPKPEGLPTMV
GYQAAGAAPFLRGAPVEQPETVATAIRIGNPQSWNHAKAVVRDSQGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMNQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttataccggtctcgtagatcgttatcgtgaccgcttgccagtt
tctgcaacgacacgagctatttctttaggtgaaggaaatactccactgattaaactagag
aatattccacgtatcattggcaaagatgtcgaaatttatgtcaagtatgaaggtttgaac
ccaacaggttcatttaaagaccgtggtatgactatggcagtcaccaaagccgttgaagaa
ggttcaaaagcgattatctgtgcatcgacaggcaatacctcggctgccgctgctgcctat
gcagcacgtgcaggcatcaaagcgtttgttttgattcctgaaggtaaaattgccatgggt
aaaatggcgcaagccatgatgtatggcgcaatcactatgcaaatccgcggtaacttcgat
gatggtatgcgtctagtaaaagaagttgccgatcaagcgcctgtcaccattgttaactca
attaatccgtatcgtttgcaaggtcaaaaaaccattgcttacgaaatcgtggaagcttta
ggtcgtgcgcctgattatcactgcttacccgtgggtaatgcaggtaatatcacggcacac
tggatgggttataccgaagcagtcgctaaccagccagcagatcaatttgagcaagtgatt
tatgatgccgctacagaccagtttactggtcctaaacctgaaggcttaccaacgatggtc
ggttatcaggcagcaggtgcagcaccattcttacgtggtgcaccagtggagcaaccagaa
actgttgcaactgcgattcgtattggtaatccacaaagctggaaccacgctaaagccgtt
gtacgtgactctcaaggctggtttgatgaacttcaagatagcgagattctagaagctcaa
cgtttactctctatgtacgaaggtgtatttgtagaacctgcttctgcagcgtctatcggt
ggtgcaatccgtgacattaaagcgggcaaaattgctgaaggttctgtgattgtatgtaca
gtgacaggaaatggcttaaaagatccagataccgccatcaaacaatgtgctgatgcagtc
atgctatccattgatgccacaatgaatcaggtaaaagattcgattctttctaatatgtaa

DBGET integrated database retrieval system