KEGG   Acinetobacter sp. ADP1: ACIAD0335Help
Entry
ACIAD0335         CDS       T00185                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex alpha subunit [Includes: Enoyl-CoA hydratase; Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase; 3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA epimerase]
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00071  Fatty acid degradation
aci00280  Valine, leucine and isoleucine degradation
aci00281  Geraniol degradation
aci00310  Lysine degradation
aci00362  Benzoate degradation
aci00380  Tryptophan metabolism
aci00410  beta-Alanine metabolism
aci00640  Propanoate metabolism
aci00650  Butanoate metabolism
aci00903  Limonene and pinene degradation
aci00930  Caprolactam degradation
aci01040  Biosynthesis of unsaturated fatty acids
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
aci01200  Carbon metabolism
aci01212  Fatty acid metabolism
Module
aci_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACIAD0335 (fadB)
   00650 Butanoate metabolism
    ACIAD0335 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ACIAD0335 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ACIAD0335 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACIAD0335 (fadB)
   00310 Lysine degradation
    ACIAD0335 (fadB)
   00380 Tryptophan metabolism
    ACIAD0335 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACIAD0335 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ACIAD0335 (fadB)
   00281 Geraniol degradation
    ACIAD0335 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACIAD0335 (fadB)
   00930 Caprolactam degradation
    ACIAD0335 (fadB)
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ACIAD0335 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ACIAD0335 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ACIAD0335 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ACIAD0335 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: CAG67289
UniProt: Q6FF68
Position
complement(330397..332550)
Genome map
AA seq 717 aa AA seqDB search
MIHAGNAITVQMLSDGIAEFRFDLQGESVNKFNRATIEDFQAAIEAVKNHPEVKGLIVTS
AKSTFIVGADITEFGQNFAQGEKAIVEWALPVHDIFNSFEDLDIPKVAAINGMALGGGFE
MCLVCDYRVMSDQAQVGLPEIKLGIFPGFGGTVRLSRLIGIDNAVEWIAMAAPKKPAAAL
KDGAVDAVVSADKLQEAAIDLVKQALAGRVDWKAKRQEKLNPVKLNPLEQMMAFNTAKGA
VLAKANPAQYPAPKLMLDSLQAGASLGRDEALKVETEGFAKAAITPQAEALIGLFLNDQI
IKKTSKKHEKGAHPVNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMQEANG
LLTKQVERKKLTPAKMGETLARIRPTLSYDEFKEVDIVIEAVTENPKIKEAVLADTEAKV
RDNTIIASNTSTISITRLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEQTSEEAVATTV
VLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLLKDGADFQQIDKVMEKFGWPMGPAY
LMDVVGIDTGVHGAEVMAEGFPDRMKPDYKGSIQTMYEAKRLGQKNDVGFYKYELDKKGK
KAKTVDSTAYEVIAPVVTSEKREFDAQEIIDRMMLALCNETVRCLEDNIVATPAEADMAM
IMGIGFPPFRGGPCRYIDQTGVAEYVALCNKYAHLGKAYEAPQLLRDMAENNKKFYG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgctggcaatgccattaccgtccaaatgctttcggacggaattgcagaattc
cgctttgacttacaaggtgagtcggtcaacaaatttaaccgtgcaaccatcgaagacttt
caagctgcgattgaagcagtcaaaaatcatcctgaagttaaaggcttgattgtcacttca
gcaaaatctacgtttatcgtgggtgcagatattaccgagtttggacaaaactttgctcaa
ggcgaaaaagccattgttgaatgggctttacctgtacatgacatctttaatagctttgaa
gatttagacatccctaaagttgctgcgatcaatggcatggcgttgggtggtggttttgaa
atgtgtttggtctgtgactaccgtgtgatgtcagatcaagcacaagtaggcctaccagaa
attaaactgggaattttcccaggctttggcggtactgttcgtttaagccgtttgattggt
attgacaatgccgttgaatggattgccatggcggcaccgaaaaaaccagcggcagcactc
aaagatggtgccgtggatgctgtagtttcagcagacaaattacaggaagctgcaattgat
ctggtaaaacaggcgttggcaggtcgtgtcgactggaaagccaaacgtcaggaaaagcta
aaccctgtgaagcttaatccacttgagcaaatgatggcttttaatacagcaaaaggtgct
gtactagcaaaagccaatccggctcaatatcctgcaccgaaactcatgcttgattcatta
caagcaggtgcaagcttgggtcgtgatgaagcactcaaagttgaaacagaaggttttgct
aaagctgcaatcacaccacaggcagaagcattaattggtcttttcttgaatgatcagatc
attaagaaaacctctaagaaacatgaaaaaggcgcgcatcctgtgaatcaggcagcggta
ctgggtgctggtatcatgggcggtggtattgcttatcaagcagcgagtaaaggcacgcca
attatcatgaaagatattggtaatccgcagcttgcgttaggtatgcaagaagccaatggt
ctactcaccaaacaggtcgagcgcaaaaaacttacccctgcaaaaatgggcgaaactttg
gcgcgtatccgtccaactttaagctatgacgagtttaaagaagtggatatcgtgattgaa
gcggtcacagaaaatccaaaaatcaaggaagcagtcctggcagataccgaagcaaaagtg
cgtgacaacaccattattgcctcaaatacctcaaccatttcaattacgcgtttagcaaaa
gcactcaagcgtccagaaaactttgtaggtatgcacttctttaatccagtacacatgatg
ccactggttgaagtcattcgtggtgaacagacttctgaagaagctgttgcaacgactgtg
gttctggctcagaagatgggtaaaaccccaatcgtggtcaatgattgccctggcttcttg
gtcaaccgcgtattgttcccttactttggggcctttgatctattactgaaagatggcgct
gacttccagcaaatcgataaagtcatggaaaaatttggctggccaatgggccctgcttat
ctgatggacgtggtgggaattgacactggtgttcatggtgccgaagtcatggcagaaggt
ttcccagatcggatgaagccagattacaaaggttcaattcaaaccatgtatgaagccaag
cgtctaggtcaaaaaaatgacgttggtttctacaaatatgaactcgacaaaaaaggcaag
aaagcaaaaacggttgattcaaccgcatatgaagtcattgcaccagttgtgactagtgaa
aaacgtgagtttgatgctcaggaaatcattgatcgtatgatgctggcgctttgcaatgaa
accgtacgctgccttgaagacaatatcgttgcaacacctgctgaagcagatatggcaatg
attatggggattggtttcccaccatttcgtggtggcccatgtcgatatatcgatcaaaca
ggtgtggctgagtatgttgcgctttgcaacaagtacgcacatttgggtaaagcttatgaa
gcgccgcaactactgcgcgacatggctgaaaacaacaagaaattttacggttaa

DBGET integrated database retrieval system