KEGG   Acinetobacter sp. ADP1: ACIAD0363Help
Entry
ACIAD0363         CDS       T00185                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00010  Glycolysis / Gluconeogenesis
aci00051  Fructose and mannose metabolism
aci00562  Inositol phosphate metabolism
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
aci01200  Carbon metabolism
aci01230  Biosynthesis of amino acids
Module
aci_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD0363 (tpiA)
   00051 Fructose and mannose metabolism
    ACIAD0363 (tpiA)
   00562 Inositol phosphate metabolism
    ACIAD0363 (tpiA)
Enzymes [BR:aci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACIAD0363 (tpiA)
Exosome [BR:aci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACIAD0363 (tpiA)
  Exosomal proteins of bladder cancer cells
   ACIAD0363 (tpiA)
  Exosomal proteins of melanoma cells
   ACIAD0363 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAG67313
UniProt: Q6FF44
Position
356605..357402
Genome map
AA seq 265 aa AA seqDB search
MSGSTIIPWVVGNWKMNPKQSDAIQLVQQFKDLLKQQPISEQYCHVGVAPIAIALTTIQS
ELATANRQVATVAQDVSRFAGTGAYTGEISAELLTDSQIRYVLIGHSERRDLLGDHVEIL
KAKLSHALNAGMTVIYCVGESLEQREQGLAEQIVLQQICDIAPVVSAEQWQHQIVIAYEP
IWAIGTGRTASPEDAQAIHAKIREGLCQITPAGSQIALLYGGSVKPENAVELAACPDING
ALVGGASLNAESFYKIAQAFAQTQQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctcgactattattccttgggttgtcggcaattggaaaatgaatcctaaacaa
tctgatgccattcaacttgtacaacaatttaaagatttattaaagcagcaacctatttct
gagcagtattgtcatgtgggtgttgcacctatagccatcgcattgacaacaattcaaagc
gaactggcaacggcaaaccgtcaagttgcgacggttgcgcaagatgtttctcgttttgct
ggtacaggtgcttatacaggtgaaataagtgccgaattgctgacagatagccaaattcga
tatgtcctgattggacattctgagcgtcgtgacttacttggtgatcatgttgaaatttta
aaagcaaaactaagccatgccttaaatgcaggaatgacagtcatttattgtgtaggtgaa
agtcttgaacagcgtgaacaaggtttggctgagcagattgtgttgcagcaaatctgtgat
attgcacctgtagtgagtgccgagcagtggcagcatcaaatcgtcattgcttatgaaccg
atctgggccatcggtacaggccgtactgcatcaccagaagatgcgcaagccattcatgcc
aaaattcgtgaaggtttatgtcagattaccccagcaggctctcaaattgcattactttat
ggtggtagtgtcaagccagaaaatgcggtagagttggcggcttgtccagatattaatggg
gcattggttggcggagcatcactcaatgctgagtcattttataaaattgctcaagcattt
gcccaaacgcaacaatag

DBGET integrated database retrieval system