KEGG   Acinetobacter sp. ADP1: ACIAD0363Help
Entry
ACIAD0363         CDS       T00185                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACIAD0363 (tpiA)
   01230 Biosynthesis of amino acids
    ACIAD0363 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD0363 (tpiA)
   00051 Fructose and mannose metabolism
    ACIAD0363 (tpiA)
   00562 Inositol phosphate metabolism
    ACIAD0363 (tpiA)
Enzymes [BR:aci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACIAD0363 (tpiA)
Exosome [BR:aci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACIAD0363 (tpiA)
  Exosomal proteins of bladder cancer cells
   ACIAD0363 (tpiA)
  Exosomal proteins of melanoma cells
   ACIAD0363 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356605..357402
Genome map
AA seq 265 aa AA seqDB search
MSGSTIIPWVVGNWKMNPKQSDAIQLVQQFKDLLKQQPISEQYCHVGVAPIAIALTTIQS
ELATANRQVATVAQDVSRFAGTGAYTGEISAELLTDSQIRYVLIGHSERRDLLGDHVEIL
KAKLSHALNAGMTVIYCVGESLEQREQGLAEQIVLQQICDIAPVVSAEQWQHQIVIAYEP
IWAIGTGRTASPEDAQAIHAKIREGLCQITPAGSQIALLYGGSVKPENAVELAACPDING
ALVGGASLNAESFYKIAQAFAQTQQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctcgactattattccttgggttgtcggcaattggaaaatgaatcctaaacaa
tctgatgccattcaacttgtacaacaatttaaagatttattaaagcagcaacctatttct
gagcagtattgtcatgtgggtgttgcacctatagccatcgcattgacaacaattcaaagc
gaactggcaacggcaaaccgtcaagttgcgacggttgcgcaagatgtttctcgttttgct
ggtacaggtgcttatacaggtgaaataagtgccgaattgctgacagatagccaaattcga
tatgtcctgattggacattctgagcgtcgtgacttacttggtgatcatgttgaaatttta
aaagcaaaactaagccatgccttaaatgcaggaatgacagtcatttattgtgtaggtgaa
agtcttgaacagcgtgaacaaggtttggctgagcagattgtgttgcagcaaatctgtgat
attgcacctgtagtgagtgccgagcagtggcagcatcaaatcgtcattgcttatgaaccg
atctgggccatcggtacaggccgtactgcatcaccagaagatgcgcaagccattcatgcc
aaaattcgtgaaggtttatgtcagattaccccagcaggctctcaaattgcattactttat
ggtggtagtgtcaagccagaaaatgcggtagagttggcggcttgtccagatattaatggg
gcattggttggcggagcatcactcaatgctgagtcattttataaaattgctcaagcattt
gcccaaacgcaacaatag

DBGET integrated database retrieval system