KEGG   Acinetobacter sp. ADP1: ACIAD0363Help
Entry
ACIAD0363         CDS       T00185                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:aci01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aci01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aci00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aci00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aci00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356605..357402
Genome map
AA seq 265 aa AA seqDB search
MSGSTIIPWVVGNWKMNPKQSDAIQLVQQFKDLLKQQPISEQYCHVGVAPIAIALTTIQS
ELATANRQVATVAQDVSRFAGTGAYTGEISAELLTDSQIRYVLIGHSERRDLLGDHVEIL
KAKLSHALNAGMTVIYCVGESLEQREQGLAEQIVLQQICDIAPVVSAEQWQHQIVIAYEP
IWAIGTGRTASPEDAQAIHAKIREGLCQITPAGSQIALLYGGSVKPENAVELAACPDING
ALVGGASLNAESFYKIAQAFAQTQQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctcgactattattccttgggttgtcggcaattggaaaatgaatcctaaacaa
tctgatgccattcaacttgtacaacaatttaaagatttattaaagcagcaacctatttct
gagcagtattgtcatgtgggtgttgcacctatagccatcgcattgacaacaattcaaagc
gaactggcaacggcaaaccgtcaagttgcgacggttgcgcaagatgtttctcgttttgct
ggtacaggtgcttatacaggtgaaataagtgccgaattgctgacagatagccaaattcga
tatgtcctgattggacattctgagcgtcgtgacttacttggtgatcatgttgaaatttta
aaagcaaaactaagccatgccttaaatgcaggaatgacagtcatttattgtgtaggtgaa
agtcttgaacagcgtgaacaaggtttggctgagcagattgtgttgcagcaaatctgtgat
attgcacctgtagtgagtgccgagcagtggcagcatcaaatcgtcattgcttatgaaccg
atctgggccatcggtacaggccgtactgcatcaccagaagatgcgcaagccattcatgcc
aaaattcgtgaaggtttatgtcagattaccccagcaggctctcaaattgcattactttat
ggtggtagtgtcaagccagaaaatgcggtagagttggcggcttgtccagatattaatggg
gcattggttggcggagcatcactcaatgctgagtcattttataaaattgctcaagcattt
gcccaaacgcaacaatag

DBGET integrated database retrieval system