KEGG   Acinetobacter sp. ADP1: ACIAD0630Help
Entry
ACIAD0630         CDS       T00185                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ACIAD0630
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ACIAD0630
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ACIAD0630
Lipid biosynthesis proteins [BR:aci01004]
 Desaturase
  First
   ACIAD0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(619039..620208)
Genome map
AA seq 389 aa AA seqDB search
MNPPLPQAPINWIAVFALIFLPVLAIIAIPLYAYHHDFSIGAWVSMFVLLGMSSLGITAG
YHRLWAHRAYEATLPLKIMLMIMGTFAVQNSILFWASGHRTHHRHVDDIEKDPYSIKNGF
WYAHFGWMLRNYPAAEPDFKNAPDLLNDKLVMFQHKYYVALVIATHVVILTAVGWAVGDI
WGVVLLGGLLRLILSHHVTFFINSLCHMWGKRPYTDENTARDNFWLAIATWGEGYHNYHH
IFQYDYRNGVKWWQYDPTKWLIWSCSKLGLAKNLRRIPSFNIKKAELAMKFKYAEQDLAI
YGHDVNSDLAQMKQRIAQEYDAFTHTLNDWAKLKEQELQSKKAAVAEKLHQMDHKLKVDF
QLLEHRLSHHRECLETLMRNVKKRNTVSE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctcccctacctcaagccccaattaactggattgccgttttcgccttaattttt
ttacccgttcttgcaattattgcgatcccgctttatgcctatcatcacgatttcagcatt
ggcgcatgggtgagcatgtttgttttgctaggaatgagcagtctaggcattacagctggc
tatcaccgtctatgggcgcatcgcgcatatgaagcgactttacctttaaaaatcatgcta
atgattatgggtacatttgcggttcagaatagtattttgttctgggcttcgggtcaccgt
actcatcatcgtcatgtcgatgatatcgaaaaagatccgtactcaatcaaaaacggtttc
tggtatgcccatttcggctggatgttacgaaattatcctgctgccgaaccagattttaaa
aatgcaccagatttgctcaatgataaactggtgatgttccaacacaaatactacgttgct
cttgttatcgcgacgcacgttgtcattttaactgctgtaggttgggctgttggcgatatc
tggggcgttgttttactcggtggcttgcttcgactgattttgagtcatcatgtgacattc
ttcattaactcgctttgccatatgtggggcaaacgcccatatacagatgaaaataccgct
cgtgataacttctggctcgcgattgcgacatggggcgaaggctaccacaactatcatcac
atttttcagtatgactaccgaaatggcgtgaaatggtggcaatacgatccaacaaaatgg
ttgatctggagctgctcgaaactcgggcttgctaaaaacttacgtcgtattccaagcttt
aatatcaagaaagccgaattggcaatgaagtttaagtatgcagaacaagatctggcaatt
tatggtcatgatgtcaactctgatttagcacagatgaaacaacgcattgcacaggaatat
gatgcatttacccatacgttgaatgattgggccaaactcaaagaacaagagttacagtct
aaaaaagctgcggttgcagaaaaacttcatcaaatggatcacaaactgaaagttgatttt
caactattagaacatcgtttaagccatcatcgtgaatgtcttgaaaccttgatgcgcaac
gttaaaaagcgcaacactgtgtctgaataa

DBGET integrated database retrieval system