KEGG   Acinetobacter sp. ADP1: ACIAD0636Help
Entry
ACIAD0636         CDS       T00185                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACIAD0636 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACIAD0636 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACIAD0636 (trpB)
Enzymes [BR:aci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACIAD0636 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
625346..626557
Genome map
AA seq 403 aa AA seqDB search
MIDYTQYPDARGHFGIHGGRFVSETLMAALEDLENLYNRMKNDEQFLAEFDRDLAYYVGR
PSPLYYAERWSKKLGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIAETGAGQ
HGVATATIAARLGLECVVFMGAEDVKRQAMNVYRMRLLGATVIPVQSGSKTLKDAMNEAM
RDWVTNVDSTYYVIGTVAGPHPYPQLVRDFQSIIGREARRQIQEQAGRLPDALVACVGGG
SNAIGLFYPFLNDQDVKMYGVEAAGHGIETGKHSAPLNAGHVGVLHGNRTYLMSDPQGQI
IETHSISAGLDYPGVGPEHSFLKDMHRVEYVPIDDNEALQGFRDLTRIEGIIPAIESAHA
MAYVTKLAPTMDKDQIIIANVSGRGDKDLMTVARIDGIEMVEM
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgattgactatacgcaatatccagatgctcgtgggcattttggtattcatggcggacgt
tttgtatcagaaacacttatggcggcacttgaagatttagaaaatctttacaaccgcatg
aaaaatgacgaacagtttctggcagaatttgaccgcgatcttgcctattatgtaggtcgt
cctagtccactttattatgctgaacgatggtcaaagaagctcggtggtgcgcaaatttac
ttaaaacgtgaagacctgaatcatacaggttcacacaaagttaataacaccattggtcag
gcattattggccaagctttctggcaaaaaacgtatcattgcagaaacgggtgcgggtcag
catggtgttgcaactgcaacgattgcagcacgtttgggcctcgaatgtgtcgtgttcatg
ggtgcagaggatgtcaagcgtcaggccatgaatgtgtatcgcatgcgtttgcttggtgcg
acagttattcctgtacaaagtggttcaaaaaccctaaaagatgccatgaatgaagccatg
cgcgattgggtgaccaatgtagacagtacttattatgtgattggcactgtagcaggtcca
catccttatcctcagttggtgcgtgatttccagtcgattattggacgtgaagcccgtcgc
cagattcaggaacaggcaggacgtttgccagatgcgcttgtggcgtgtgtcggtggtggt
tctaacgcgatcgggctgttttatccattcctgaatgatcaagacgtcaaaatgtatggt
gttgaagctgcgggtcatggtatcgaaacaggcaagcattctgctccgcttaatgcaggg
catgtgggtgtattacatggtaaccgcacctatttgatgagtgatccacaaggtcagatt
atcgaaacccacagtatttctgcgggtctggattaccctggtgttggccctgagcatagc
tttctcaaagacatgcatcgtgttgaatacgtacctattgacgataacgaagcattacaa
ggcttccgtgaccttactcgcattgaaggcattattcctgcaatcgagagtgctcatgca
atggcttatgtcaccaagctggcacctaccatggacaaagatcagattatcattgccaat
gtgtcaggtcgtggcgataaagacctaatgacggtggcacgtattgatggcatcgagatg
gtagaaatgtaa

DBGET integrated database retrieval system