KEGG   Acinetobacter sp. ADP1: ACIAD0642Help
Entry
ACIAD0642         CDS       T00185                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACIAD0642 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACIAD0642 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACIAD0642 (trpA)
Enzymes [BR:aci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACIAD0642 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
630720..631523
Genome map
AA seq 267 aa AA seqDB search
MSRLATRFEQLKSQQRKALVSYVMAGDPQPQVSVPLLHKMVEAGVDVIELGLPFSDPMAD
GPVIALAAERALAAGTNTLDALNMVKEFRQNDSETPVVLMGYLNPVEVIGYEKFVSHAKA
CGVDGVLLVDLPPEEAKEFDVVLKQHDMDQIFLLAPTSTDQRIEHVVKQASGFIYYVSLK
GVTGAATLDVTEAAERIAKIKTKTSVPVGVGFGISDAASAKAMGQVADAVIVGSAFVKPF
ATLAIDQAVEQTVNKVKELRAALDELV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcttgccacccgttttgaacagcttaaatcccaacaacgtaaagcactggtt
tcatatgtgatggcaggtgatccacagccgcaagtgtctgtaccattgttgcacaagatg
gtagaggcgggtgtagatgttattgagctcggtctgcctttttcagacccgatggcagat
ggtccagtgattgcgcttgcagccgaacgagctctggctgctggaaccaataccctcgat
gcactgaatatggtgaaggagtttcgtcagaacgatagcgaaacacctgtggttctgatg
ggctatctgaatcctgttgaagtgatcggttacgaaaaatttgtatctcatgctaaggca
tgtggcgtagatggtgttcttttagtggatttaccaccagaagaagcaaaagaatttgat
gtggtgcttaagcagcatgatatggatcagatctttttacttgcaccgacttcgacagac
cagcgaatcgagcacgtagtgaagcaggccagtggttttatttactatgtttcactcaag
ggtgtgactggggccgcaacattggacgtgactgaagcggcggaacgtatcgccaagatt
aaaaccaaaacgtccgtacctgttggtgtcggttttgggatcagtgatgcagcatcggcc
aaagcgatgggtcaggttgcagatgcagtgattgtaggaagtgctttcgttaaacctttt
gctacgttagcaatcgaccaagcggttgaacaaacggtcaataaagtcaaggagcttcga
gcagcgctcgatgagttagtatga

DBGET integrated database retrieval system