KEGG   Acinetobacter sp. ADP1: ACIAD0663Help
Entry
ACIAD0663         CDS       T00185                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aci01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:aci00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656263..657555
Genome map
AA seq 430 aa AA seqDB search
MMRRLSTQDQSFKQVFADLLAFETVNDPELLKTVDQIIADVRQYGDEHVLKLTQQFDRHP
AHQFSDLELTQEQLKTAFEALTAEIREALELAAERIRSFHQAQKQEGWSYVDALGNTLGQ
KVTPLDRVGIYVPGGLASYPSSVLMNAIPAHVAGVPEIIMVVPAPNGELNSLVLAAAYLA
GVSRIFTIGGAQAVAALAYGTQTIPAVDKITGPGNRFVAAAKRAVFGQVGIDMIAGPSEI
LVYAEGQNNAKWLAMDLLSQAEHDTVAQAIFITPDEALLDEVAQAIEEHLAALPKADIAR
TSIANRGALVLVKDRDEAIELINQVAPEHLELCLDESEAMSQKIRHAGAIFMGRYTPEAI
GDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIMCSQEGVKSLAKAADVLAQQENLDA
HARSARYRYQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcgacgtttatcgactcaagatcaaagctttaaacaggtttttgcagatctgtta
gcgtttgaaactgtaaatgatcctgaacttttaaaaacagtagaccaaatcattgctgat
gtacgtcagtatggtgatgaacatgttcttaagctcactcagcagtttgatcgacatcca
gcgcatcaattttcagatttggaactgacccaagagcaacttaaaactgcatttgaggcc
ttaacggctgaaatacgtgaagcccttgaattggctgcggagcgtattcgcagttttcac
caagctcaaaagcaagaaggttggagctatgtggatgcattgggaaataccttgggtcaa
aaagtgacacctttagatcgtgtcggtatttatgtccctggtggtttggcatcttatccg
tcttcggtacttatgaatgcaattccagcacatgtggctggtgtaccagaaattatcatg
gtcgtgccagcaccaaatggtgagttgaattctctggttttggctgcggcatatttggct
ggagtaagccgtatttttacgataggtggagcgcaggctgttgccgctttggcttatggc
acccagactattccagcagtagataaaattactggacctggtaacagatttgttgcggcc
gctaagcgcgctgttttcggtcaggtcggaattgacatgatcgccggtccatctgaaatt
ctggtatatgcagaaggtcagaataatgctaaatggttggcaatggatcttttgtcacaa
gcggaacacgataccgttgcacaagccatttttattacaccagatgaagcattacttgat
gaagtcgctcaagcgattgaagaacatttagctgcattacctaaagctgatattgcgcgg
acttcaattgcaaatcgtggagcactggttctggttaaggatcgtgatgaggccattgaa
ttaattaatcaggtggcccctgaacatttagagctgtgtctggatgaatcagaagcgatg
agtcagaagattcgtcatgcaggtgcaatctttatgggacgctatacaccagaagcgatt
ggcgattactgtgcaggtccgaatcatgtattaccaacatcgggtaccgcacgtttttca
tcgcctcttggggtgtatgactttcaaaaacgttcaagtttgatcatgtgttcgcaagaa
ggcgtgaaaagcttggcaaaggcggcagacgtattggctcaacaggaaaatctggatgca
catgcacgttctgcacgttatcgttatcagtaa

DBGET integrated database retrieval system