KEGG   Acinetobacter sp. ADP1: ACIAD0887Help
Entry
ACIAD0887         CDS       T00185                                 

Gene name
rimI
Definition
ribosomal-protein-alanine acetyltransferase (acetylating enzyme for N-terminal of ribosomal protein S18) (EC:2.3.1.128)
Orthology
K03789  
ribosomal-protein-alanine N-acetyltransferase [EC:2.3.1.128]
Organism
aci  Acinetobacter sp. ADP1
Brite
Enzymes [BR:aci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.128  ribosomal-protein-alanine N-acetyltransferase
     ACIAD0887 (rimI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
870782..871240
Genome map
AA seq 152 aa AA seqDB search
MIRDMQAADIDIVTQIEAMVQTHPWSKQQFAESLNSYQATVIELNKQVVGFCILQPVLDE
ANLLLMAIHPNMQGRGLGFKLLEESINQLKNNPVQIFLEVRESNLSAVGLYEKSGFHQID
LRRHYYPNPDGTREHAIIMVKACSDNFADLFK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgatatgcaagctgctgatattgatatcgttactcaaattgaggcaatggtt
cagacacatccatggtcaaaacaacaatttgcagaatccttaaattcgtatcaagcgact
gtgattgaattgaacaagcaagtcgtgggcttttgtatactacagcctgtattggacgaa
gcaaatctgcttctgatggcaattcatcccaatatgcagggaagaggtcttggttttaag
ttacttgaagaatctatcaatcagctcaaaaataatcctgtgcaaatttttttggaagta
agagaaagtaatttatctgcggttggactatatgaaaaaagcggtttccatcaaattgat
ttaagacgtcattattatcctaatcctgatggtacacgagagcatgcaatcattatggtc
aaagcatgcagtgataactttgcagatctttttaagtaa

DBGET integrated database retrieval system