KEGG   Acinetobacter sp. ADP1: ACIAD0902Help
Entry
ACIAD0902         CDS       T00185                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD0902 (algC)
   00030 Pentose phosphate pathway
    ACIAD0902 (algC)
   00051 Fructose and mannose metabolism
    ACIAD0902 (algC)
   00052 Galactose metabolism
    ACIAD0902 (algC)
   00500 Starch and sucrose metabolism
    ACIAD0902 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    ACIAD0902 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    ACIAD0902 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ACIAD0902 (algC)
Enzymes [BR:aci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ACIAD0902 (algC)
    5.4.2.8  phosphomannomutase
     ACIAD0902 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
885462..886886
Genome map
AA seq 474 aa AA seqDB search
MDIKQAFPFQIFRAYDIRGKLNILTPERIVAIAHGLASQYLDAEQTCVVIGYDARLTSPS
YAQLIQSVFEQRGLTVINMGCCSTPLMYFTARHYEGNGVMITASHNPKSDNGIKWLIDNE
PPSPEMIQQVGWSASQIRVDASDFQSCTAIPHQIKTEFFNVYQDTILQDIHLNRSFKVVL
DGLHGSAGQCAKILLEKLGCDVIALRCEANGEFPDHAPDPSQAKHLESLRQQIILQRADI
GIALDGDGDRLVVIDEHTNIISADRLISLFSHLCLQTLPAREIVFDVKCSTMVRNTVLNC
SGTPKMIRTGSSFLRKYLAQSQGHAIFGGEYAGHYVFNDGRGFGFDDGIYAALRLLEYLS
QSPQQTIFQLLQAYPERCSTEDLYISTHHANPEVVLKYIEQFAQHIPAQLSKIDGIRLDF
EDGFGIIRASNTGEYFTVRFDADTPQRLAEIRQIFIVMLQKQYPNIAHDLSQAY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaagcaggcttttccgtttcagatttttcgtgcatacgatattcgtggaaaa
ctgaatatattgacacctgaacggatcgttgcaattgctcatggattggcatctcaatat
ttggatgcagagcaaacatgtgtcgttattggatatgatgcccgtttaaccagtccctct
tatgcacagttaattcagtctgtatttgagcaacgtggtctaacggtgatcaacatgggg
tgttgttctacgcccctaatgtacttcacggcacgccactacgaaggaaatggagtgatg
atcacggccagccataacccaaaatcagacaatggcattaagtggctcattgataacgaa
ccaccatcaccagagatgattcagcaagtagggtggtcagcttcccagattcgggtggat
gcgtcagattttcaatcttgtactgcaataccacatcaaatcaaaaccgagttttttaat
gtttatcaagatacgatccttcaagatattcatttaaaccgatcctttaaagtggtattg
gatggtttacatggttccgcaggtcaatgtgcaaaaattttactcgaaaaactcggatgt
gacgtgattgcactgcgctgcgaggcaaatggtgaatttccagatcatgcacctgatcct
tctcaggcaaagcatcttgagtctttgcgccagcagatcatattgcagcgggctgacatc
ggaattgcacttgatggagacggagaccgtttggtggtgattgatgaacacaccaacatc
attagtgcagatcggctcatttcattgtttagtcatttatgcttgcaaacattacccgca
cgtgaaattgtatttgacgtaaaatgttcaacgatggtccgaaataccgtattgaactgt
tctggcacacctaagatgattcgtactggcagcagctttttacgcaagtatctggctcaa
tcacaaggacatgcgatttttggtggcgaatatgcaggtcattatgtgtttaatgacggg
cgtggttttggttttgatgatggcatttatgcagctttgcgcttgctcgaatatttaagc
caatctccacagcaaaccatttttcaattattacaagcctatcctgagcgttgttctact
gaagatctgtatattagtacgcatcatgcgaacccagaagtcgttttaaaatatatagag
cagtttgcacaacatatacctgcacagttaagtaaaattgatggtatccgtcttgatttt
gaagacggttttggcattattcgagcatccaacacgggtgaatattttactgtgcgtttt
gatgcggatacgccccagcgtttagctgaaatcagacaaatatttatcgtcatgctgcaa
aagcaataccctaacattgcacatgatctttcacaggcttattaa

DBGET integrated database retrieval system