KEGG   Acinetobacter sp. ADP1: ACIAD1057Help
Entry
ACIAD1057         CDS       T00185                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase (EC:3.1.1.5 3.1.2.- 3.4.21.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ACIAD1057 (tesA)
Enzymes [BR:aci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ACIAD1057 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ACIAD1057 (tesA)
Lipid biosynthesis proteins [BR:aci01004]
 Fatty acid synthase
  Component type
   ACIAD1057 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1051907..1052542)
Genome map
AA seq 211 aa AA seqDB search
MQLYNMFLDGKWAKWFLIGSFSVIPFTVSAKTILILGDSLSAGYGINPEQGWVALLQKRL
DQQFPKQHKVINASVSGETTSGALARLPKLLTTYRPNVVVIELGGNDALRGQPPQMIQSN
LEKLIQHSQKAKSKVVVFGMKIPPNYGTAYSQAFENNYKVVSQTYQVKLLPFFLDGVAGH
KSLMQNDQIHPNAKAQSILLNNAYPYIKGAL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgtataacatgtttttagacgggaaatgggcaaaatggttcttgattggttca
tttagcgtaataccttttacagtttcggcaaaaaccattcttatcttaggcgacagtctg
agtgcgggttatggcattaaccccgaacagggctgggtcgctttattacaaaaacgtctg
gatcaacaatttcccaagcagcataaagtcattaatgccagtgtaagtggggaaaccacc
agtggtgctttagctcgtttacccaaactacttactacttatcgacctaatgtggtggtc
attgagcttggtggtaatgatgcattaagaggacaaccgcctcaaatgattcaaagtaat
ctggaaaaattaatccagcacagccaaaaggcaaaatctaaagtcgtggtgtttggaatg
aaaataccaccaaattatggcactgcctatagtcaggcatttgaaaataattataaggta
gtgagtcaaacatatcaggttaagttgttgccattttttcttgatggtgtggctggacac
aaaagtctaatgcaaaatgaccagatccatccaaatgccaaagcccagtcaatcttgcta
aataacgcatacccatatattaaaggcgctttataa

DBGET integrated database retrieval system