KEGG   Acinetobacter sp. ADP1: ACIAD1211Help
Entry
ACIAD1211         CDS       T00185                                 

Gene name
ddc
Definition
L-2,4-diaminobutyrate decarboxylase (EC:4.1.1.-)
Orthology
K13745  
L-2,4-diaminobutyrate decarboxylase [EC:4.1.1.86]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycine, serine and threonine metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aci00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1213493..1215025
Genome map
AA seq 510 aa AA seqDB search
MVDFAEHRKALLCNDAASIAEYQSAMDEAVKAVAAWLQNDKMYTGGSIKELRSAIAFNPS
KEGLGLHQSLGRMVELFLNKSLKVHHPYSLAHLHCPTMVTSQIAEVLINATNQSMDSWDQ
SPAGSLMEVQLIDWLRQKVGYGVGQAGVFTSGGTQSNLMGVLLARDWAIAKNFTDENGQP
WSVQRDGIPAEAMRNIKVICSENAHFSVQKNMAMMGMGFQSVVTVPVNENAQMDVDALEK
TMSHLQSEGKIVACVVATAGTTDAGAIDPLKKIREITTKYGAWMHIDAAWGGALILSNDY
RDMLDGIELSDSITLDFHKHYFQSISCGAFLLKDEANYRFMHYEAEYLNSAYDEEHGVPN
LVSKSLQTTRRFDALKLWMTVEALGEELYGSMIDHGVKLTREVADYIKATEGLELLVEPQ
FASVLFRVVPDGYPVELIDTLNQNVADELFARGDANIGVTKVGAVQSLKMTTLSPVATLE
NVKGLLAMVLAESDRIKDSIAAGTYVPAID
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttgcagaacatcgtaaagctttgctctgtaatgatgctgcatccattgct
gaatatcagtcagcaatggatgaggcagtgaaagctgtcgcagcatggttgcaaaatgac
aaaatgtatacgggtggtagcattaaagagttgcgttcagcaattgcttttaacccatct
aaagaaggcttgggtttacatcagtcgctcggccgtatggttgaattgtttctgaataaa
agcctgaaagttcatcatccgtactcgcttgctcacttacattgtccaacgatggtcacc
agccaaattgctgaggtgttgattaacgcaaccaatcagtcaatggattcttgggatcag
agccctgcaggttcattgatggaagttcagttgatcgactggcttcgtcaaaaagtaggg
tacggcgtaggtcaggctggtgtattcacctcaggtggaacgcaatcaaacctgatgggc
gtgttacttgcacgtgactgggcaattgccaaaaattttacagatgaaaatggtcagccg
tggtctgtacagcgtgatggtattcctgccgaagcgatgcgtaacatcaaagtcatttgt
tctgaaaatgcacatttttctgtgcaaaagaacatggcaatgatgggcatgggcttccag
tccgttgtgactgttcctgtaaatgaaaatgcacagatggatgttgatgcgcttgaaaaa
accatgtcacatctgcaatctgaaggtaagattgtagcgtgtgtagtggcgactgcaggc
acaaccgatgcaggcgcgattgatccattgaagaaaattcgtgaaatcaccacaaaatac
ggcgcgtggatgcatatcgacgcagcgtggggtggtgcactgattctgtcaaatgattat
cgtgatatgctagatggtattgagctatctgactcaatcacgcttgatttccacaagcat
tatttccaaagcattagctgtggtgcattcttgctcaaagatgaagcgaattatcgtttc
atgcattatgaagcagaatatctgaactcggcttatgatgaagaacacggtgtaccaaac
ctggtctctaaatcattacaaacaacacgtcgctttgatgcgcttaagttgtggatgact
gtagaagcactgggtgaagagctatacggttcaatgattgatcatggtgtgaagttgaca
cgtgaagtggctgactacattaaggcaaccgaaggactcgaattgttggttgaaccacaa
tttgcatcggtattgttccgtgtagtaccagacggttatcccgttgaattgattgatacc
ttgaatcaaaacgttgcagatgaactttttgcacgtggtgatgccaatattggtgtaact
aaggtaggtgcagtacagtcattgaaaatgacgactttaagccctgttgcgacattggaa
aatgtcaaaggtctattggcgatggtactggctgaaagtgatcgaatcaaagattcaatt
gctgctggaacttacgtgccagcgattgattaa

DBGET integrated database retrieval system