KEGG   Acinetobacter sp. ADP1: ACIAD1354Help
Entry
ACIAD1354         CDS       T00185                                 

Definition
(GenBank) putative phospholipase A1 precursor (PldA)
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00564  Glycerophospholipid metabolism
aci00565  Ether lipid metabolism
aci00590  Arachidonic acid metabolism
aci00591  Linoleic acid metabolism
aci00592  alpha-Linolenic acid metabolism
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACIAD1354
   00565 Ether lipid metabolism
    ACIAD1354
   00590 Arachidonic acid metabolism
    ACIAD1354
   00591 Linoleic acid metabolism
    ACIAD1354
   00592 alpha-Linolenic acid metabolism
    ACIAD1354
Enzymes [BR:aci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ACIAD1354
    3.1.1.32  phospholipase A1
     ACIAD1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 VasI RL11D
Motif
Other DBs
NCBI-ProteinID: CAG68221
UniProt: Q6FCI9
Position
1349277..1350437
Genome map
AA seq 386 aa AA seqDB search
MAFRFIEGIPTSLGVFGVVGSLCMSHAHAIEAVQTSATITPTSPAACIGLESNSDRLACY
DALFKVADTAKTTPVIEQKAALNPSPSVEQSELNPQSIKEKIGNLFAIEGPRIDPNTSLL
DRRWELSEKSKLGTWNIRGYKPVYLLPIFWTSKKNEFPSSPNPENTVHENQNLTSAESKF
QLSLKTKAWENIFGNNGDLWLGYTQSSRWQVYNADESRPFRETNYEPEASLIFRTNYEFL
GLNGRLLGVTLNHQSNGRSDPLSRSWNRVIFNIGLERDNFALVLRPWIRIQEEAKNDNNP
DIEDYVGRGDLTAFYRWKDNDFSLMLRHSLKDGDKSHGAVQFDWAFPISGKLRGNFQLFN
GYGESLIDYNHRATYVGLGVSLMNWY
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttagatttattgaggggattcccacaagtttgggcgtgttcggtgtggtaggt
tcattgtgtatgtcgcatgcacatgcaattgaagctgtacagacttctgcaacaattacg
cccaccagtcctgcggcttgcattggtttggagtcgaattcagatcgtctggcttgttat
gatgctctgtttaaagtagcagatacggcaaaaacaactccagttattgaacaaaaagct
gctttgaacccttcgccgtcggtagagcagtctgagctcaatcctcaatctattaaggaa
aaaattggtaatctttttgcgattgaaggtccaagaattgatccgaatacatccttactg
gataggcgctgggagctctccgaaaaatcaaaattaggtacatggaatattcgtggttat
aaacctgtctatttattacctattttttggacatctaaaaagaatgaatttccttcgagt
ccaaatcctgaaaatacagtgcatgaaaatcagaatttaacttcggctgaatccaagttt
caattatctttaaaaaccaaagcctgggaaaatatttttggcaataacggagatttatgg
ctagggtatacccagtcttctcgttggcaggtttacaatgcagacgagtcacgtccgttt
cgtgaaaccaattatgaacctgaggcaagcctaattttccgaaccaattatgagttcttg
ggattaaacggccgacttttgggggtaactttaaatcaccagtcaaatggtcgttctgat
ccattatcaagaagctggaatcgtgtcatctttaatataggattagagcgagataatttt
gcgctggtactcagaccatggattcgtattcaagaagaagccaagaacgacaataatccc
gatatcgaggattatgtaggacgtggtgatttaactgctttttatcgctggaaagataat
gatttttctttaatgctgcgtcattcattaaaagatggtgataaatcgcatggtgcggtg
cagtttgattgggctttcccaatttcaggtaagcttcgtggaaattttcagttatttaat
ggttacggtgaaagcctgattgattataaccatcgtgcaacttatgttggtttgggcgtt
tcactgatgaactggtattga

DBGET integrated database retrieval system