KEGG   Acinetobacter sp. ADP1: ACIAD1354Help
Entry
ACIAD1354         CDS       T00185                                 

Definition
phospholipase A1 precursor (PldA) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:aci00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:aci00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aci00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:aci00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:aci00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349277..1350437
Genome map
AA seq 386 aa AA seqDB search
MAFRFIEGIPTSLGVFGVVGSLCMSHAHAIEAVQTSATITPTSPAACIGLESNSDRLACY
DALFKVADTAKTTPVIEQKAALNPSPSVEQSELNPQSIKEKIGNLFAIEGPRIDPNTSLL
DRRWELSEKSKLGTWNIRGYKPVYLLPIFWTSKKNEFPSSPNPENTVHENQNLTSAESKF
QLSLKTKAWENIFGNNGDLWLGYTQSSRWQVYNADESRPFRETNYEPEASLIFRTNYEFL
GLNGRLLGVTLNHQSNGRSDPLSRSWNRVIFNIGLERDNFALVLRPWIRIQEEAKNDNNP
DIEDYVGRGDLTAFYRWKDNDFSLMLRHSLKDGDKSHGAVQFDWAFPISGKLRGNFQLFN
GYGESLIDYNHRATYVGLGVSLMNWY
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttagatttattgaggggattcccacaagtttgggcgtgttcggtgtggtaggt
tcattgtgtatgtcgcatgcacatgcaattgaagctgtacagacttctgcaacaattacg
cccaccagtcctgcggcttgcattggtttggagtcgaattcagatcgtctggcttgttat
gatgctctgtttaaagtagcagatacggcaaaaacaactccagttattgaacaaaaagct
gctttgaacccttcgccgtcggtagagcagtctgagctcaatcctcaatctattaaggaa
aaaattggtaatctttttgcgattgaaggtccaagaattgatccgaatacatccttactg
gataggcgctgggagctctccgaaaaatcaaaattaggtacatggaatattcgtggttat
aaacctgtctatttattacctattttttggacatctaaaaagaatgaatttccttcgagt
ccaaatcctgaaaatacagtgcatgaaaatcagaatttaacttcggctgaatccaagttt
caattatctttaaaaaccaaagcctgggaaaatatttttggcaataacggagatttatgg
ctagggtatacccagtcttctcgttggcaggtttacaatgcagacgagtcacgtccgttt
cgtgaaaccaattatgaacctgaggcaagcctaattttccgaaccaattatgagttcttg
ggattaaacggccgacttttgggggtaactttaaatcaccagtcaaatggtcgttctgat
ccattatcaagaagctggaatcgtgtcatctttaatataggattagagcgagataatttt
gcgctggtactcagaccatggattcgtattcaagaagaagccaagaacgacaataatccc
gatatcgaggattatgtaggacgtggtgatttaactgctttttatcgctggaaagataat
gatttttctttaatgctgcgtcattcattaaaagatggtgataaatcgcatggtgcggtg
cagtttgattgggctttcccaatttcaggtaagcttcgtggaaattttcagttatttaat
ggttacggtgaaagcctgattgattataaccatcgtgcaacttatgttggtttgggcgtt
tcactgatgaactggtattga

DBGET integrated database retrieval system