KEGG   Acinetobacter sp. ADP1: ACIAD1606Help
Entry
ACIAD1606         CDS       T00185                                 

Definition
acetyl-CoA synthetase/AMP-(fatty) acid ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aci01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aci00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aci00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aci00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:aci00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1602316..1603959
Genome map
AA seq 547 aa AA seqDB search
MLDYQTVATSFDFHRAANEMLSGSLDQVNACYECCDRHAESNPEKIALYWQGKDGRQYQY
TFAQLQKWSSQFANFLKSQGVQTGDRISGLLPRTPELLVVILGAWRIGAVYQPLFTAFGP
KAIEHRVQLAKSKLVVTDLGNRSKLDEVAHCPPIMTVIGEKDHAVNDQDLNFWKQVSQAS
DHCDLVLQDIQKPFLLMFTSGTTGPAKPLEVPLKALIAFGHYMKDAIGLRTDDVFWNLAD
PGWAYGLYYAITGPLLLGHATLFYEGGFSIDSLCQIIEDYKITNLAGAPTAYRMMMAADP
AKIACLKGKLRVISSAGEPLNPEVFRWFKHTLDAPIFDHYGQTEVGMVVCNHHGLSHDVR
AGTAGFASPGYRVAVVDEQGNELPADTAGILAVDIQKSPMMWFGGYQESRKSPFLKHYYL
TGDTAELHADGSMSFVGRSDDVITTSGYRIGPFDVESALIEHQAVIEAAVIGVPDPERTE
IVKAFVILTAQTSPSEQLAEELRQFVKKRLSAHAYPRQVEFVTELPKTPSGKIQRFLLRN
QEIAKQS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgttggattatcaaacggtcgcaacctcatttgactttcatagagcagcaaatgaaatg
ttatctggttcactggatcaagttaatgcatgttacgaatgttgtgatcgacatgcagaa
tcaaaccccgaaaaaatagcattatattggcaaggcaaagatggtcgtcaatatcaatat
acgtttgcacaattacaaaagtggtccagtcaatttgccaattttttaaaatcacaaggg
gttcaaacaggcgatcgtatttcaggtttattacccagaacacctgaattattggtggtg
attttaggtgcttggcgaattggtgcagtttatcagccactttttacggcatttggcccg
aaagcgattgagcatcgcgtgcagcttgcaaaaagtaaattggttgtgactgatttgggt
aatcggagcaagcttgatgaagtagcgcattgtccacccatcatgacggttattggcgaa
aaagatcatgcagtaaatgatcaagacttaaatttttggaagcaagtgagtcaagcgtct
gaccactgtgatttggttttacaagacattcaaaaaccatttttactgatgtttacgtcg
ggaaccacaggccctgcaaagcctttggaagtgcctttaaaggcattaatcgcgtttggt
cattatatgaaagatgccattggtttacgcaccgatgatgtcttttggaatcttgcagat
cctggctgggcatatggtttatattatgccataaccgggccactgcttttggggcatgca
accttattttatgagggtggttttagtatcgatagtttgtgccaaattattgaggattat
aaaattaccaatttggcaggtgcaccgactgcataccgcatgatgatggcagcagatcca
gcgaaaatcgcctgcctaaagggtaaattacgtgtgataagtagtgcaggtgaaccactc
aatccagaagtatttcgttggtttaaacacactttagatgcccctatttttgatcattat
ggtcagactgaagtgggtatggtggtatgtaatcatcacggtttaagccatgatgtgcgt
gcaggaacagcaggttttgcaagtccaggctatcgtgtggccgtagtggatgagcagggc
aatgaacttccagcggatacggctggaatattggccgtcgatattcaaaagtcgccgatg
atgtggtttggtggttatcaagaaagtcgaaaatctccttttttaaagcattattactta
acaggtgatacagccgaattacatgcggatggcagtatgagttttgtagggcgtagtgat
gatgtcatcaccacatcaggctatcgtattggtcctttcgatgttgaaagtgcattaatt
gaacatcaagctgtaattgaagcagcagttattggtgtgcctgacccagaaagaacggaa
attgtaaaagcatttgtgattttgacagcacagacgagcccatcagagcaattggccgag
gaactacgccaatttgttaaaaagcgtttatcggcacatgcttatccaagacaagttgag
tttgtgacagagttgcctaaaactccaagtggtaagattcaacggtttttgttgcgtaat
caagagattgccaagcaatcctaa

DBGET integrated database retrieval system