KEGG   Acinetobacter sp. ADP1: ACIAD1611Help
Entry
ACIAD1611         CDS       T00185                                 

Definition
acetyl-CoA synthetase/AMP-(fatty) acid ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACIAD1611
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD1611
   00620 Pyruvate metabolism
    ACIAD1611
   00640 Propanoate metabolism
    ACIAD1611
  Energy metabolism
   00680 Methane metabolism
    ACIAD1611
Enzymes [BR:aci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ACIAD1611
Lipid biosynthesis proteins [BR:aci01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ACIAD1611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1608592..1610235
Genome map
AA seq 547 aa AA seqDB search
MQTLEQAYQAFDLNQLIEQQLIGHPQSINAYEECCGRYVGQNKIALIWEGLEGETKQFTF
DELATYSGQLANYFKSQGVQPGQCIAGLLPRTPELLITILATWRMGAIYQPLFTAFESKA
IEHRLSVAQTQLVVTNKEQAAKLNAVNNLKVLTVEKDSFDILDQPDFWNALKHFDAQYQS
EMITFNDHFLMMFTSGTTGLAKPVPVPLKAILSFKGYMTHAVGLNQSDSFWNLADPGWAY
GLYYGITGPLSLGHSIILDEQGFSVDRAIELIKKYKVSNLIGSPTAFRMFFGFKEKFDAE
IKDYLRVVSSAGEPLTPEVVHWFKNDLDINIYDQYGQTELGMVIANHHALEHHVKIGSAG
YAIPGYRFVVLDEHHQELSSDSIGVLAIDSAASPLFWFTGYGENNRSAFVGQYYITGDTV
KMNAFGSIDFVGRIDDVITTSGYRVGPFDVESTLLECQEVLESAVIGKPDAIRTEIVKAF
VVLKSQYKSQADQSLSEKLKQYVRGRLSKHAYPKEIEFVDQLPKTASGKIQRGVLKQQEI
SRMQLSG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacattagagcaagcatatcaagcatttgatttgaatcaattaatagagcagcaa
ttgataggccatccccaatcgatcaatgcttatgaagaatgttgtggccgttatgtggga
caaaataaaatcgcattgatttgggaagggcttgagggtgagacaaagcaattcaccttc
gatgagttggcaacttattctggtcaattggcaaattattttaagtctcaaggtgtgcaa
cccggacaatgcattgcgggtctattacctcgtactcccgaattgttgattacaatttta
gccacttggcgaatgggagctatttatcaaccgttatttactgcatttgaatcaaaagca
attgaacatcgtttgagtgtagctcagacacaactggttgtgaccaacaaagaacaagcg
gcaaaattaaatgctgtgaacaatttaaaagtcttaacagtagaaaaagattcatttgat
attttagatcaacctgatttttggaatgcacttaagcattttgatgcccaatatcaatct
gaaatgattacctttaatgatcattttttgatgatgtttacgtctggaacgactggtttg
gctaaacctgtgcctgtgccactcaaagcaattttatcttttaaaggctatatgacgcac
gctgttggattaaatcagtcagattctttctggaatctcgcagatcctggctgggcctat
ggtttgtactacgggataacagggcctttaagcctgggccatagcatcattttagatgaa
caaggatttagtgttgatcgtgcaattgaattaattaaaaaatacaaagtctctaatttg
attggatcgcctactgcctttaggatgttctttggatttaaagaaaaatttgatgctgaa
attaaagattatttacgtgtggtgagtagtgccggagaacctttaacaccagaggtcgtc
cattggtttaagaatgatttagacatcaatatttatgatcagtatggtcaaactgaactg
ggtatggtcatcgcaaatcaccatgcacttgagcatcatgtaaagattggctctgctgga
tatgcaattcctggttatcgttttgtcgtattagatgaacatcatcaagaactatcatct
gattctattggtgtattagcaatagatagtgctgcctctccattattctggtttacaggg
tacggcgaaaacaatcgaagcgcatttgttggtcagtattatattacgggtgatactgtg
aaaatgaatgcgtttggcagtatcgactttgtcgggcgtatagatgatgtaattacaaca
tcgggttatcgtgtagggccttttgatgttgaaagtactttacttgagtgccaagaggtt
cttgaatctgcggtgattggtaagcctgatgcaatcagaactgaaattgtaaaagctttt
gttgttttaaaatcacaatacaagtctcaggctgatcaatcactgagcgaaaaacttaaa
caatatgtccgcggacgcctttcaaagcatgcttatcctaaagaaatagaatttgtagat
caattacctaaaacagccagtggcaaaatccagcgtggagttttaaaacaacaggaaatc
tcccgtatgcagttatcgggttaa

DBGET integrated database retrieval system