KEGG   Acinetobacter sp. ADP1: ACIAD1993Help
Entry
ACIAD1993         CDS       T00185                                 

Gene name
fruA
Definition
phosphotransferase system, fructose-specific IIBC component (EC:2.7.1.69)
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
aci  Acinetobacter sp. ADP1
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aci00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:aci02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1984979..1986706
Genome map
AA seq 575 aa AA seqDB search
MMQTLKSLLFVINSTQQYVNASILAKKLTQAAAKSGLESKTITIKDSVPNQEFDLVIFIG
QLPKNLSTFNAVKFSQIDLGNANQNADEVLQQAFQHSKSPDELNATTSNSAQKAQRFVAI
TACPTGVAHTFMAAEALQQGADRLGYIIDVETQGSVGAKNILSAEAIEAADIVILATDIE
VNTDRFVGKRVYRCSTGFALKQTDKAFDQAIAEAKLLESSKQASSNATGSTNKEKTGIYK
HLLTGVSFMLPMVVAGGLLIALSLCFGLNAAEQSGSLAYVLKQIGVTAFTLMVPMLSGYI
AYSIADRPGLTPGLIGGLLATQLQAGFLGGIVSGFLAGYIALFLAKKIKLPTSLESLKPI
LIVPLLGTLSVGLIMYYVVGHPVAQIFEMMKDFLNNMGTTNAVLMGIVLASMMCIDLGGP
INKAAYAFTVGLLTTNTYMPMAATMAGGMVPAIGMALATFFAKNKFNIGERDAGKAAFVL
GLCFISEGAIPFAAKDPMRVIPTCIAGGAVTGALVALFHCELVTPHGGVFVLLIPNAINH
AWLYLIAIAAGSLVTGISYAVLKRRETTALQSQTV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
ctgatgcaaacacttaaatctcttttatttgtgatcaatagcacgcaacagtatgtcaat
gcttcgattttggcaaagaaattaacgcaagctgctgctaaatcggggctggaaagtaaa
acaataacaattaaagattcagttccaaatcaagaatttgatttggttatctttattggt
cagctacccaagaatctttcaacattcaatgctgtaaaattttctcagattgatcttgga
aatgccaatcaaaatgcggatgaagtacttcaacaggcatttcagcattcaaaaagccca
gatgaactcaacgctaccacgtccaattcggctcagaaagcccaacgttttgtagcgatt
acggcctgtccaacaggtgtagcacacacgtttatggccgcagaagccttacagcaaggc
gcggatagactcggttacatcattgatgtagaaacacaaggctctgttggagcaaaaaat
attctatctgccgaagccattgaagccgcagatattgtcattttggcaacagatatcgaa
gtcaatacagatcgttttgtaggtaaacgggtttaccgttgcagcacaggttttgcttta
aaacaaacagataaagcttttgatcaggcaattgccgaagcaaaactacttgaatcatcc
aagcaagcatctagcaatgccacaggctctaccaacaaagaaaaaacaggcatttataaa
cacttattgactggtgtttcttttatgcttccaatggtggtggcaggtggcttgctcatt
gcactttcactctgttttggtttaaatgctgccgaacaaagcggtagcttggcctatgta
ttaaaacaaattggggttacagcatttaccctaatggttcccatgctttctggatatatt
gcgtattcaattgcagatcgtccaggtttgaccccaggcctgattggtggactcctcgca
actcaattacaagcaggctttcttggtgggattgtttctggatttctggcaggatacatt
gcattattccttgccaaaaaaatcaagctcccaacgagccttgaatcattaaagccaatt
ctgattgtacctttgctcggaacactttctgtcggtctgatcatgtattatgtcgttggt
catccagtggctcagatctttgagatgatgaaagacttcctaaataacatgggtaccacc
aatgctgtattaatgggcattgtacttgcctcaatgatgtgtatcgaccttggtggtcca
atcaataaagcagcctacgcgtttaccgtaggtctactgaccaccaacacgtatatgccg
atggcagcaacaatggcaggcggtatggttcctgcaattggtatggctttagcaaccttt
tttgccaaaaacaaatttaatataggtgagcgcgatgcaggtaaagccgcatttgtatta
ggtctttgctttatttccgagggtgcaattccttttgctgcaaaagatccaatgcgtgtt
atccccacttgtattgcgggtggcgccgttactggtgctttggttgcgctattccattgt
gagctggtaacaccacatggcggggtatttgtactactcattccaaatgcgattaaccat
gcttggttatatctgattgcaattgcagcaggcagtttggttacaggtattagttatgct
gttttaaaacgtcgtgagacgacagcattacaaagtcaaactgtataa

DBGET integrated database retrieval system