KEGG   Acinetobacter sp. ADP1: ACIAD2085Help
Entry
ACIAD2085         CDS       T00185                                 

Gene name
gpo
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ACIAD2085 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACIAD2085 (gpo)
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ACIAD2085 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2068191..2068673)
Genome map
AA seq 160 aa AA seqDB search
MTNLYQFEAELLEGDTKSLADYQGKVLLIVNTASKCGFTPQFAGLEKIYEKYKDRGFEVL
GFPCNQFGGQDPGSNNEIGAFCQRNYGVSFPMFAKVDVKGPEAHAIFRYLTREAKGILGS
ENIKWNFTKFLVGRDGKVLNRYAPTTKPESLEEDIEKALA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgactaacctttaccaatttgaagctgagctattagaaggtgatacaaaatcactagcc
gattatcaggggaaagtacttttgattgtcaatacagccagcaaatgcgggtttactccc
caatttgcgggtctggaaaaaatatacgaaaaatataaagatcgtgggtttgaggttctg
ggctttccgtgtaatcaatttggaggacaagacccaggaagcaataacgaaatcggtgct
ttttgccagcgtaattatggtgtgagctttcctatgtttgccaaagtggacgtaaaaggt
cctgaagcgcatgcgatatttcgttatttgactcgtgaagcaaaggggattttgggaagt
gaaaatatcaaatggaatttcaccaagttcttggtcggacgcgacggaaaagtgttgaat
cgatatgcgccaaccaccaaacctgagagtctggaagaagatatcgagaaagcattggca
taa

DBGET integrated database retrieval system