KEGG   Acinetobacter sp. ADP1: ACIAD2087Help
Entry
ACIAD2087         CDS       T00185                                 

Definition
(GenBank) putative PLP-dependent aminotransferase (EC:2.6.1.-)
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    ACIAD2087
   01230 Biosynthesis of amino acids
    ACIAD2087
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACIAD2087
   00290 Valine, leucine and isoleucine biosynthesis
    ACIAD2087
   00220 Arginine biosynthesis
    ACIAD2087
Enzymes [BR:aci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ACIAD2087
    2.6.1.66  valine---pyruvate transaminase
     ACIAD2087
Amino acid related enzymes [BR:aci01007]
 Aminotransferase (transaminase)
  Class I
   ACIAD2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
2069321..2070751
Genome map
AA seq 476 aa AA seqDB search
MSQKKSVIFKNLLPVIKQYQQAGFTHEKIVALLKDQHDLDLVTTETFKSYLYRYAKVTPT
PSESLKMTNTIQTPREIKKSSKLEHVCYDIRGPVLRAANEMEEQGHKIIKLNIGNPAPFG
FEAPQEIINDVALNLPNAIGYTDSKGIFPARKAICQYYQQKGIRDMHVNDVYVGNGVSEL
IVMAMQGLLNDGDEMLVPMPDYPLWTAAVNLSGGTAIHYKCDEENSWYPDIVDMESKITP
NTRGIVVINPNNPTGSVYPRHVLQQIVALAKKHDLILFADEIYDKIIYDGIEHVALASLA
GDQLCISFNGLSKSYRVAGYRSGWMAITGDKSRAKDYIEGLDMLASMRLCANHQAQYAIQ
TALGGYQSINDLIRPSGRLYEQRNIAWEMLNEIHGVSCVKPEGAMYCFPKLDPNIYQVED
DEQLMLDFLRAEKVLLVQGTGFNWPTHDHFRLVFLPAENELREAITRLSRFLATRR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaaaaaaagcgttatttttaaaaacctactccctgtgattaaacaatatcaa
caggctggattcacgcatgaaaaaattgttgctttactcaaagaccaacatgatcttgat
cttgtaacaactgaaacatttaaaagctatttatatcgttatgcaaaagtgacccccact
ccatccgagagcctcaaaatgacgaacacaattcaaaccccacgagaaattaaaaaatct
tctaagctcgagcatgtatgctacgacattcgtggacctgtgttacgagcggccaatgaa
atggaagaacaaggtcataaaattattaaacttaatattggcaaccctgcgccatttggt
ttcgaagcacctcaagaaattattaatgatgtcgcattaaatctacctaacgcgattggt
tacactgactccaaaggtatcttccctgcacgtaaagccatttgccagtattatcagcaa
aaaggtattcgcgatatgcacgtcaatgatgtgtatgttggaaacggggtatccgaactg
attgtcatggccatgcaaggtttgctaaatgatggcgatgaaatgctggttccaatgcca
gattatccactctggacagcagcagtaaatttatctggtggtacagcaattcactataaa
tgtgatgaagaaaatagctggtatccagatattgtcgatatggaaagcaaaataacgcct
aatactcgtggtattgtggtgattaatccaaataatccaacaggttcggtttatccaaga
cacgtgctccagcaaattgtagctttagctaaaaagcacgatctgattttatttgccgat
gaaatctatgacaagattatttacgatggaattgaacacgtagcacttgcctctcttgca
ggcgatcaactctgtatttcctttaatggtttatcaaaatcttatcgtgttgcaggttat
cgttcaggctggatggcgattacaggtgataaatcacgtgctaaagattacatcgaaggt
ctggatatgctggcatccatgcgcctatgtgccaaccatcaagcacaatatgcgattcaa
acggctttaggcggttatcagtcgattaatgacttgattcgtccaagcggacgtttatac
gagcaacgcaatattgcatgggaaatgcttaatgaaatacacggcgtcagttgtgtaaaa
cctgagggtgccatgtattgctttccaaaactagatccgaatatttatcaggtcgaggat
gatgaacagttgatgctggatttcttacgtgcagagaaagtgcttctggtacaaggaaca
ggatttaactggccaacgcatgatcacttccgcttggtcttcttaccagcagagaatgag
cttcgagaagcaattacacgattatcacgctttctcgcaacgcgccgttaa

DBGET integrated database retrieval system