KEGG   Acinetobacter sp. ADP1: ACIAD2312Help
Entry
ACIAD2312         CDS       T00185                                 

Gene name
recR
Definition
(GenBank) recombination protein, gap repair
  KO
K06187  
recombination protein RecR
Organism
aci  Acinetobacter sp. ADP1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aci00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACIAD2312 (recR)
DNA repair and recombination proteins [BR:aci03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ACIAD2312 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ACIAD2312 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2278015..2278611)
Genome map
AA seq 198 aa AA seqDB search
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFGLAHALHEASSHIHECKICH
SLTENEICDICLSNDRDQHLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEE
IGIPYLIQRLSSGEIEEVILATNATVEGQATAHYLLEATKHLPVHMTRIAQGVPQGGELE
YVDSHTLSQAVHNRMKMK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagtgatcgatttgaacaactggttcaagcactacgtatcttaccaagcgttggg
ccgaaatcggctcaacgcatggcgttacatttactcatgaagaatcgagaaggtgcattt
ggccttgcgcatgctctgcatgaggcatcttcacatattcatgaatgcaagatttgtcat
tcactgactgaaaacgaaatttgtgatatttgtctatccaatgaccgagatcagcatttg
ttatgtgtggtggaatctccagccgatgtcatggcgattgaacaaagtggtagctttcgc
ggtaagtaccatgttttagggggacatttatctccactggatggaataggtcccgaagaa
atcggaattccttatttgattcagcgcttaagctctggtgaaattgaagaggttattcta
gcgactaatgcaactgtagaaggacaagcaacagcacattatttgcttgaagcaaccaaa
catcttccagtacatatgactcgtattgcacagggtgttccacagggcggcgaacttgag
tatgtagacagtcataccttgagtcaggctgtacataatcgtatgaaaatgaaatag

DBGET integrated database retrieval system