KEGG   Acinetobacter sp. ADP1: ACIAD2341Help
Entry
ACIAD2341         CDS       T00185                                 

Gene name
pyrF
Definition
(GenBank) orotidine-5'-phosphate decarboxylase (OMP decarboxylase) (OMPDCase) (OMPdecase)
  KO
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ACIAD2341 (pyrF)
Enzymes [BR:aci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     ACIAD2341 (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2305660..2306343)
Genome map
AA seq 227 aa AA seqDB search
MSIIVALDAKSQYDALSIADQLDPSLCRVKVGKELFTHDGPQTVRILQDRGFELFLDLKF
HDIPNTTAQAVCAAADLGVWMVNVHASGGRKMMETCVERLKAGNYRTQLIAVTVLTSMGR
EDLRDIGLDVEPFEQVKRLAQLTQESGLDGVVCSAQEAKMLRDLLGTEFALVTPGIRPEG
ANADDQKRIVTPKQAMLDGSTHLVIGRPITKSERPNEMLKQILSSLA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattattgttgccttagacgcaaagagccaatatgacgctttgagcattgctgat
cagctcgatccatcactttgtcgtgtaaaagtgggcaaagagctttttactcatgatggt
ccacaaacagtaagaatcttacaagatcgtggttttgagttgtttttagaccttaaattt
catgacattccaaacaccacagcacaggctgtatgtgctgcggcagacttaggtgtatgg
atggtcaatgttcatgcgtctggcggtcgtaaaatgatggaaacctgtgttgaacgactt
aaagctggaaattaccgtactcaacttattgcggtaacggtattaacctctatggggcgt
gaagatttacgtgacattggtttagatgttgaaccttttgagcaagttaaacgtctggca
cagctaacgcaagaaagcggtctggatggtgtggtatgttctgctcaagaagcaaaaatg
ttacgtgatttactaggaacagaatttgctttggtcactccaggtattcgacctgagggt
gcaaatgcagatgaccaaaaacgcattgtgacgccaaagcaggcaatgttggatggttcg
actcatctagtcattggtcgtccaattacaaaatccgaacgaccaaatgaaatgttgaaa
cagattttatcgagtctggcttaa

DBGET integrated database retrieval system