KEGG   Acinetobacter sp. ADP1: ACIAD2392Help
Entry
ACIAD2392         CDS       T00185                                 

Gene name
rbsK
Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACIAD2392 (rbsK)
Enzymes [BR:aci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ACIAD2392 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: CAG69167
UniProt: Q6F9U6
Position
2348944..2349882
Genome map
AA seq 312 aa AA seqDB search
MSSTPPLLTVIGSINVDHILGLEHFPHPGQTLNGQSYQVAFGGKGANQAVAAGRSGANTS
FIACVGSDAVGEQIRHQLIKDNIDTQAVRAVEGFTTGVALIFVNQHAENFIGIHAGANAA
LDIAYIDQHAELIQRSSAILLQLETPLATILHAAKLAKAAGVKVILNPAPACELPEELLR
LVDIITPNETEALSLTNVIVHDDHDAAEAANVLHQKGIKTVVITMGSRGVWLSEYGQGKM
IEGFKVSAIDTIAAGDTFNGAFVTALLEGKTAQDAARFANAAAAIAVTRSGAQPSVPWRQ
EIDLFLSAQTAL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaacccctcctttgcttactgtgattggtagcattaatgtcgatcatatcctt
ggcctcgagcactttccacatcctggacaaaccttgaatggtcagagctatcaggttgca
tttggtggaaaaggtgcaaatcaggctgtggcagcaggccgaagtggcgccaataccagt
tttattgcctgtgtaggtagcgatgccgtgggtgaacaaattcgtcatcaactcatcaaa
gacaacattgatactcaggccgtgcgtgctgttgaaggtttcaccacaggtgtcgcactg
atttttgttaatcagcatgcagagaacttcattggtattcatgccggtgccaatgctgcg
cttgatattgcgtacatcgatcagcatgcagagctgattcaacgctcaagcgcaattctg
ttacagctcgaaacaccattagccactattttacacgctgcaaagcttgccaaagccgct
ggtgtaaaagtgattttaaatccggcgccagcctgtgagttacctgaagaattattacgt
ttggtcgatattattacccccaacgaaaccgaagcgttaagcctcaccaatgtgattgtg
catgatgatcatgacgctgccgaagcggcaaatgtgctgcatcaaaaaggtattaaaact
gtagtcatcacgatgggctctcgtggtgtctggctaagtgaatatggtcagggcaaaatg
attgaaggttttaaagtgagtgcaatcgataccattgccgcaggcgatacgtttaatggt
gcatttgtgacggcacttcttgaaggaaaaaccgctcaagacgctgcacgctttgccaat
gcagccgctgcaattgccgttacccgatctggtgcccagccttctgtgccatggcgtcaa
gaaattgatctgtttctttctgctcaaacggcactataa

DBGET integrated database retrieval system