KEGG   Acinetobacter sp. ADP1: ACIAD2407Help
Entry
ACIAD2407         CDS       T00185                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACIAD2407
Enzymes [BR:aci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ACIAD2407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2368619..2369011)
Genome map
AA seq 130 aa AA seqDB search
MAYRQIQSWGDVQFSNVYKIPCRDGVGEDYWNSACLLVSDLSAQEIELHLKQLEALSGRV
RPSHQISLDVDLIAWGSTLDQMQFNPKKLPLAVDVKIPLYELWPNTDLEVKYLNYPKIDF
NVNLQVISSS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcgacaaattcagtcatggggagatgtgcagttttcaaatgtgtataaaatt
ccatgtcgtgatggggtgggagaggactactggaattctgcctgcttactggtgtctgat
ttaagtgcacaagagattgagttgcatttaaaacaacttgaagcactttctgggcgtgtt
cggccatcacatcaaatctcgttggatgtcgatctaatcgcgtggggcagtacacttgac
cagatgcaatttaatccaaagaaactgcctttagctgtagatgtaaaaatcccactttat
gagttatggcctaatacagatttagaagtaaaatatttaaattatccaaaaattgatttt
aatgttaatctgcaagtgatttcttcatcataa

DBGET integrated database retrieval system