KEGG   Acinetobacter sp. ADP1: ACIAD2509Help
Entry
ACIAD2509         CDS       T00185                                 

Gene name
bdhA
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00072  Synthesis and degradation of ketone bodies
aci00650  Butanoate metabolism
aci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ACIAD2509 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ACIAD2509 (bdhA)
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ACIAD2509 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N Polysacc_synt_2 SBP_bac_3 Ribosomal_L12 NAD_binding_2 Epimerase 2-Hacid_dh_C Sacchrp_dh_NADP Methyltransf_25 DFP
Motif
Other DBs
NCBI-ProteinID: CAG69277
UniProt: Q6F9I7
Position
complement(2464428..2465213)
Genome map
AA seq 261 aa AA seqDB search
MSKQLDTKVAFITGSASGIGLEIAKKFAAEGAKVVISDVNAEKCEDAVKQLKQQGFDALA
APCDVTDEQAYQAAIELTQKHFGTVDILINNAGFQHVAAIEDFPTEVFQKLIAVMLTGAF
IGIKHVFPIMKAQKSGRIINMASINGLIGFAGKAGYNSAKHGVIGLTKVAALESAKDGIT
VNALCPGYVDTPLVRGQIADLAKTRNVSETTALEDVILAMVPQKRLLTVEEIADYAIFLC
SDKAGGVTGQAVVMDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaacaattagacactaaggttgcatttattacaggttctgcaagtggaattggt
ctcgaaattgcaaaaaaatttgcagcagaaggtgccaaagtggtcatctcggatgtcaat
gcagaaaaatgtgaagatgcagtgaaacagcttaagcaacaaggttttgacgcgcttgcc
gctccatgtgatgtaacagacgagcaggcttatcaagcggcaatcgaactgacccaaaaa
cactttggaaccgtcgatattttgatcaataatgcaggttttcagcatgtagcagcaatt
gaagatttcccaactgaggtgtttcaaaagttgatcgctgtgatgcttacaggggcattc
attggcatcaagcatgtatttccaatcatgaaagcacagaagtctggacgcattatcaat
atggcatcaattaatggcctgattggttttgctggaaaagcaggttataacagtgcgaaa
cacggagttatcgggctgaccaaagtggcagcgcttgaatctgccaaagatggtattacc
gtcaatgcgttgtgtccaggctatgtagatacaccgctcgttcgtggacaaattgccgat
ctggccaaaacacgcaacgtcagtgaaaccacagcattggaagacgtgattttggcaatg
gtgccccaaaaacgtttacttacagttgaagaaattgcagattatgcaattttcctatgt
agtgacaaggctgggggggtaacaggtcaggctgtggtcatggatggtggatataccgca
caataa

DBGET integrated database retrieval system