KEGG   Acinetobacter sp. ADP1: ACIAD2614Help
Entry
ACIAD2614         CDS       T00185                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aci00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACIAD2614 (ruvA)
Enzymes [BR:aci01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ACIAD2614 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2569766..2570380
Genome map
AA seq 204 aa AA seqDB search
MNRMIGCLIGEVFALEAPTVLLNVNGVGYEIDTPLSTFCQLQKGQHVTLWTHLVVREDAQ
QLYGFIDAQEKLIFRTLLKVNGVGPKMALGILSTLSIELFIHTIEHDDINTLIKVPGVGR
KTAERLMIELRDRFKALSVQATTGSTVTSAQIQFSSNSPIAEAEAALQSLGYKPIEAQKA
IAAVKADYTEAADLIRAALKSMMK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcgcatgattggttgtttaattggtgaagtatttgcgctagaagctcccactgtt
ctgctgaatgtgaatggtgtcggttatgaaattgatactccattatctacattttgccaa
ttacaaaaaggtcagcatgttaccctgtggacacatcttgtggtacgtgaagatgctcaa
caattgtatggtttcatcgatgcacaagaaaagctgattttcagaacattacttaaggta
aacggcgttggccctaaaatggcactcggtattttatcaacacttagtatcgaattattc
atccataccatcgaacatgatgatattaacaccctgattaaagttcctggtgtaggacga
aaaacagccgaacgcttaatgattgagctgcgtgatcgcttcaaggctttgtctgtacaa
gcaacaacaggttcaactgtaacatctgcccaaatccagtttagttcaaactctcctatt
gcagaagcagaagccgctttgcaatctttgggttacaagccgattgaagcgcaaaaagca
attgcagctgtcaaagctgactatacagaagccgcagatttaattcgcgcagctttaaaa
tcgatgatgaagtga

DBGET integrated database retrieval system