KEGG   Acinetobacter sp. ADP1: ACIAD2875Help
Entry
ACIAD2875         CDS       T00185                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase, component of 2-oxoglutarate dehydrogenase complex (E2)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00020  Citrate cycle (TCA cycle)
aci00310  Lysine degradation
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
aci01200  Carbon metabolism
Module
aci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACIAD2875 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ACIAD2875 (sucB)
Enzymes [BR:aci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ACIAD2875 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CAG69603
UniProt: Q6F8L2
Position
complement(2816279..2817487)
Genome map
AA seq 402 aa AA seqDB search
MATEIKAPVFPESVADGTIATWHKKVGEAVSRDEVICDIETDKVVLEVVAPADGQLVSII
KDEGETVLSDEVIAQFQEGAVSGANETQAVQSDSKVEQAAAKTEAGAAPVVERAQPVSDQ
APAVRKALTESGISASDVQGTGRGGRITKEDVVNHQSKPAAQPLSVAVGERIEKRVPMTR
LRKRVAERLLAATQETAMLTTFNEVNMKPIMEMRAQYKDAFEKRHGARLGFMSFFVKAAT
EALKRYPAVNASIDGDDIVYHGFYDIGVAVSSDRGLVVPVLRDTDRMNYAEVENGIRDYA
VKARDGKLGIEDMTGGTFTITNGGTFGSLLSTPILNTPQTAILGMHKIQERPMAVNGQVE
ILPMMYLALSYDHRLIDGKEAVGFLVTIKELLEEPAKLILDL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattaaagcaccggtattcccagagtcagttgcagatggaaccattgca
acatggcataagaaagttggggaagcagtatcacgtgatgaagtcatttgtgatattgaa
actgataaagttgttttagaagtggttgctccagctgatggtcaacttgtttctattatc
aaagacgaaggcgaaacagttttatctgacgaagtgattgcacaattccaagaaggtgca
gtgtcaggtgcaaatgaaactcaagctgttcaaagcgactctaaagtagagcaggctgcg
gctaaaactgaagcgggtgcagctccagttgttgagcgtgcgcaacccgtttctgatcaa
gctccagcagttcgcaaggctttgactgagtctggtatcagtgcatcagacgttcaaggt
actggtcgtggtggtcgtatcaccaaagaagatgtcgtcaatcatcaatctaaaccagct
gcacaaccactgagtgttgcagtgggtgagcgtatcgaaaaacgtgttccaatgacacgt
cttcgtaagcgtgttgctgaacgtcttcttgctgccactcaagaaacagcaatgttgaca
acgtttaacgaagtcaacatgaaaccaatcatggaaatgcgtgcacagtataaagatgca
tttgaaaaacgtcatggtgcgcgtcttggctttatgtctttctttgttaaagcagcaact
gaagcattgaagcgttatcctgcggtgaatgcatctatcgatggcgatgacatcgtttat
cacggtttctacgatattggtgtagctgtatcttctgatcgtggtctcgtggttccagta
ctacgtgatactgatcgcatgaactatgctgaagttgaaaatggtatccgtgactatgct
gtcaaagcgcgtgatggcaagttgggtattgaagatatgactggcggtacatttaccatc
accaatggtggtacattcggttcattgctttctactccaattttaaatacaccacaaact
gcaatcttgggtatgcataaaattcaagaacgtccaatggcagtgaatggtcaggttgaa
attcttccaatgatgtatttggctctttcttatgaccatcgcttaattgatggtaaagaa
gcagttggcttcttggttactattaaagagcttctagaagagcctgcaaaacttattctt
gatctttaa

DBGET integrated database retrieval system