KEGG   Acinetobacter sp. ADP1: ACIAD2881Help
Entry
ACIAD2881         CDS       T00185                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00020  Citrate cycle (TCA cycle)
aci00190  Oxidative phosphorylation
aci00650  Butanoate metabolism
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
aci01200  Carbon metabolism
Module
aci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aci_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACIAD2881 (sdhD)
   00650 Butanoate metabolism
    ACIAD2881 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ACIAD2881 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF2614
Motif
Other DBs
NCBI-ProteinID: CAG69607
UniProt: Q6F8K8
Position
complement(2823519..2823884)
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRISAVVLAVYTVVIFGWILFHGGFSYEQWSGFMMTLPMKILS
LLAILSLAAHAWIGMWQVFTDYVTTRQMGPSASGLRLVLTSAVIIAVFVFAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggattaacaggttcaggttctcgcgattggtttattcagcgtatt
agtgctgtggttttggccgtatatacagttgtcatttttggctggattctttttcatggt
ggttttagctatgagcaatggtctggcttcatgatgactttgccaatgaagattttatct
ttactggcaattctgtcattggcagcacacgcatggatcggcatgtggcaggtatttact
gattatgtaacgactcgtcaaatgggtccttcggcatcaggtttacgtctggttcttaca
tcggctgtgattattgccgtgtttgtatttgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system