KEGG   Acinetobacter sp. ADP1: ACIAD2929Help
Entry
ACIAD2929         CDS       T00185                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ACIAD2929
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD2929
  Lipid metabolism
   00071 Fatty acid degradation
    ACIAD2929
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACIAD2929
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ACIAD2929
   00626 Naphthalene degradation
    ACIAD2929
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ACIAD2929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2858161..2859345
Genome map
AA seq 394 aa AA seqDB search
MAKPYYEFFCPVKVIAGNAALEHIPFELATLGSKRPMIITDKGVRANHLLEPIEAAFSST
DAEIGYIFDDVPPDSSLQTVRKAAQLYRDHHCDAIIAIGGGSVIDTSKATNILVSEGGDD
LLKYSGAHNLPKPLKPFFVIPTTSGTGSEATMVAVVSDTEKNVKMAFASYYLMPHAAILD
PRMTLTLPAHLTAMTGMDALTHCVEAYTCLASNPLSDAYASAGIKKISEHLFNVIENPSD
SQGRLELAQASTMAGIAFSNSMVGLVHSLGHALGAVAHLPHGLCMNLFLPYVLEYNKEVN
GDKIGELLLPLAGADIYAQTPANLRADKAISTILAMRDRLFSLTKLPRTLRETGKITEAQ
LDEVAEKALNDGSIIYNPKEANIQDLKAILHKAW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagccttattacgaatttttttgtccagtaaaagtgattgcaggcaatgctgct
ttagaacatattccatttgaacttgcgaccttaggttcaaaacgtccaatgatcatcacc
gataaaggtgtaagagccaatcacctgcttgaacccattgaagccgctttcagctctact
gatgccgaaattggttatatctttgatgatgtgccacctgattcaagtttacaaacggta
agaaaagcagctcagctttatcgcgatcatcattgtgatgcgattattgcaattggcggc
ggttcagtcattgatacttcaaaagctaccaatattttagtctctgaaggcggagatgac
ctgctaaaatattctggcgctcacaatttacccaaaccccttaagccattttttgtgatt
cccactacgtctggtacaggctctgaagccaccatggtggctgtggtatccgacacagaa
aaaaatgtcaaaatggcttttgcatcgtattacttgatgccacacgcggccattcttgac
ccacgtatgacactgaccttgcctgctcatttaaccgccatgacaggtatggatgcctta
acgcattgtgttgaagcatatacctgtttagcatctaatccgctcagtgatgcttacgcc
agcgcaggtatcaagaaaatcagtgaacacctttttaacgttattgaaaacccaagcgat
tcacaagggcgtctggagcttgcacaagcatcaaccatggcgggcattgccttctcaaat
tcgatggtaggtttggtacattcgctgggacatgcacttggtgcagtagcacatctgccc
catggcttatgcatgaatttatttttaccctatgtactggagtacaataaggaagtaaac
ggcgataaaattggtgagttgttattgccacttgcaggcgcagatatttatgcgcaaaca
cctgcaaatttacgcgcagataaagccatttcaaccattctggcaatgcgtgatcgcctg
tttagcttaacaaagttaccgcgtacattacgtgaaacaggtaaaattaccgaagcccaa
ctggatgaagtggctgaaaaggcgctcaatgatggttcgattatttacaacccgaaagaa
gcgaatattcaggatttaaaagcaatattacacaaagcctggtaa

DBGET integrated database retrieval system