KEGG   Acinetobacter sp. ADP1: ACIAD2989Help
Entry
ACIAD2989         CDS       T00185                                 

Definition
(GenBank) putative 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00071  Fatty acid degradation
aci00280  Valine, leucine and isoleucine degradation
aci00281  Geraniol degradation
aci00310  Lysine degradation
aci00362  Benzoate degradation
aci00380  Tryptophan metabolism
aci00410  beta-Alanine metabolism
aci00640  Propanoate metabolism
aci00650  Butanoate metabolism
aci00903  Limonene and pinene degradation
aci00930  Caprolactam degradation
aci01040  Biosynthesis of unsaturated fatty acids
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
aci01200  Carbon metabolism
aci01212  Fatty acid metabolism
Module
aci_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACIAD2989
   00650 Butanoate metabolism
    ACIAD2989
  Lipid metabolism
   00071 Fatty acid degradation
    ACIAD2989
   01040 Biosynthesis of unsaturated fatty acids
    ACIAD2989
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACIAD2989
   00310 Lysine degradation
    ACIAD2989
   00380 Tryptophan metabolism
    ACIAD2989
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACIAD2989
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ACIAD2989
   00281 Geraniol degradation
    ACIAD2989
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACIAD2989
   00930 Caprolactam degradation
    ACIAD2989
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ACIAD2989
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ACIAD2989
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ACIAD2989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C Methyltransf_31 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CAG69698
UniProt: Q6F8B7
Position
2920243..2922378
Genome map
AA seq 711 aa AA seqDB search
MSAIKYEKNADNIVILTLDSSGQSANTMNAEFRDALNDVSQKLKAETDLKGIIFRSAKKT
FFAGGDLDELIQVQPEHATEFFKMIEKLKADLRTIETLGVPVVAALNGTALGGGWELALG
CHYRIAINDPKSKFGLPEVTLGLLPGGGGIVRMVRLLGLQNAFPFLMEGKQFGVDQAKSL
GLVHDTAENQQELLDKAIVWVKANPKSQQPFDVKGYKIPGGDPKTPAVAQVLAIAPAMLR
DKTKGCYPAPEAIMAAAVEGAQVDVDTALRIESRYFTQLAIGQIAKNMIGTFWHGLNAIK
SGASRPADVARWQATKVGVLGAGMMGAGIAYSTAIKGIPVILKDVSVENAEKGKAYSQKL
LDKRVSQGRMTAEKRNQVLALITATADAADLQGCDLIIEAVFENQELKAKVTQEAEQYLA
EGGIFASNTSTLPITGLATASKDAKNFIGLHFFSPVDKMQLVEIIKGKQTSAETLAKAYD
FVQQIAKTPIVVNDSRGFFTSRVFGTFIQEGMRLLAEGVHPAKIEMAALKAGMPVGPLAI
QDEVSLTLTEHVASETRKALQAEAKDLAKTPVDEVVHTMIHELNRKGKAAGAGFYEYPEH
GKKHLWQGLDRWQKDHDISEQEMIDRFLFVQALDTLRCYEEGVLESVIDANVGSIFGIGF
APWTGGAIQFLNQNGIERSLQRSEELAQKYGERFNPPPYLKEKAQQKQIIQ
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctattaaatacgaaaaaaacgctgacaatattgtaattcttacccttgattca
tcgggtcaatctgcaaataccatgaatgcagaatttcgtgatgctttaaatgatgtcagt
caaaagctcaaagctgaaactgacttgaaagggattattttccgttcagccaaaaaaacc
ttctttgctggtggcgacttagatgagctgattcaggttcaacctgaacatgccactgag
ttttttaaaatgattgaaaagctcaaagcagatttgcgaacaatcgagactctaggtgta
cctgtggtcgcggctttaaatggcacagcacttggtggcggttgggagttagcactcggc
tgtcattatcgtattgccatcaatgatcctaaaagcaaatttggtttaccagaagtcact
ttaggtctacttccaggtgggggtggtatcgtccgtatggtacgtctactcggtttgcaa
aatgcttttccattcttaatggaaggtaaacaatttggtgttgaccaagcaaaatctctg
ggattagtccatgacacggctgagaatcaacaagaactgttagataaagcaattgtttgg
gtcaaagccaatccgaaaagtcagcagcccttcgatgtcaaaggctacaaaattcctggt
ggtgatcctaaaacacctgctgttgcacaagtgcttgcgattgcccctgccatgctacgc
gataaaaccaaaggctgttatcctgcacctgaagcgattatggcagcagcggttgaaggt
gctcaagtggatgtcgataccgcgttacgtattgaatcccgttactttactcaattggct
atcggtcaaattgcgaaaaatatgattggtacattctggcatggtctaaatgcgatcaag
tcaggtgcaagccgccctgccgatgttgctagatggcaagccactaaagtcggtgtattg
ggcgcaggtatgatgggtgcaggtattgcctactcaaccgcgatcaaaggtattcctgtc
atactcaaagatgtatctgtagaaaatgcagagaaaggcaaagcctattcgcaaaagcta
cttgataaacgtgtttcacaaggacgtatgacggcggaaaaacgtaatcaagtcttagcg
ctcattactgctaccgctgatgcagctgatttacaaggctgtgatctgatcattgaagct
gtatttgagaatcaagaactcaaagccaaggtgacgcaagaagctgaacagtatttagct
gaaggtggcatttttgcatcaaatacctccacactccccatcacaggattagcaacggca
agtaaagatgccaagaactttattgggctacatttctttagccctgtcgataaaatgcaa
ttggtagaaatcattaaaggcaaacaaacttctgccgaaacattggctaaagcctatgac
tttgtccaacaaattgcgaaaacccccatcgtggtgaatgacagtcggggcttctttacc
agtcgcgtttttggaacatttattcaagaaggtatgcgcttactggctgaaggtgtacac
ccagcaaaaattgaaatggcagcactcaaagcgggtatgcctgtggggccacttgcgatt
caggatgaagtctctttaactttaactgaacatgttgcaagcgaaacgcgcaaagcactg
caagctgaagctaaagacttagcgaaaactcctgttgatgaagtggttcacaccatgatt
cacgagctcaatcgcaaaggtaaagctgctggtgcaggtttttatgagtatccagagcat
ggcaaaaagcacttatggcaaggtcttgaccgctggcaaaaagatcatgatatttccgaa
caggagatgattgaccgcttcttgtttgttcaggcactggacactttacgctgctatgaa
gaaggtgtacttgagtctgtgattgatgccaatgtcggttcgatttttggcattggtttt
gccccatggacagggggtgctattcagttcttaaatcaaaacggaattgagaggtcactg
caacgttcagaggaattggctcaaaaatatggtgaacgttttaatccaccaccgtatctc
aaagagaaagctcagcaaaaacaaatcattcaataa

DBGET integrated database retrieval system