KEGG   Acinetobacter sp. ADP1: ACIAD3062Help
Entry
ACIAD3062         CDS       T00185                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aci00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2988627..2989115)
Genome map
AA seq 162 aa AA seqDB search
MSITTYIGMGSNLGDSRQLLQQAVRQLQTLGQVQVSRLYQSPPMGPQDQPHYLNAVVQLK
TDLDPLILLDVLQQFEHDAGRVRLRRWGERTLDLDLLLYADQNIHHERLTVPHIGLLERD
FVVIPLLDIDPTLVVKGQKLKDLTLIHDPSLTVIEDQNWVEK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcataaccacctatatcggaatgggaagtaatctgggagattcgcgccagttgctt
caacaagcagttcgacagttgcaaacattgggacaggtacaagtttcgaggctttaccag
agtccgcctatggggcctcaggatcagccacattatttgaatgcagtggtacaactgaaa
acagatctggacccgctgatattgcttgatgtactgcaacagtttgaacacgatgcagga
cgtgtacgtctacgtcgctggggtgagcggacgcttgatcttgatttgctgttgtatgca
gatcaaaacattcatcatgaacgtttaactgtaccgcatattggcttgctggaacgagat
tttgtggtcattcctttactggatattgatcctacactggttgtcaaaggccaaaaactc
aaagatttaacactcatacacgatccatcacttactgtgattgaggatcaaaactgggtt
gaaaaataa

DBGET integrated database retrieval system