KEGG   Acinetobacter sp. ADP1: ACIAD3339Help
Entry
ACIAD3339         CDS       T00185                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00010  Glycolysis / Gluconeogenesis
aci00071  Fatty acid degradation
aci00350  Tyrosine metabolism
aci00625  Chloroalkane and chloroalkene degradation
aci00626  Naphthalene degradation
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
aci01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD3339 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    ACIAD3339 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACIAD3339 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ACIAD3339 (adhA)
   00626 Naphthalene degradation
    ACIAD3339 (adhA)
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ACIAD3339 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C adh_short 2-Hacid_dh_C TrkA_N adh_short_C2 Urocanase Methyltransf_25 ELFV_dehydrog Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: CAG70008
UniProt: Q6F7F7
Position
complement(3241694..3242725)
Genome map
AA seq 343 aa AA seqDB search
MGSLMKAAVVTAFNQPLEIKDVEIPKVTSGKVLVKMIATGVCHTDLHAMHGDWPIKPSLP
FIPGHEGVGEVVEIGEGITHLKIGDTVGVPWLYSACGHCDHCYAGWETLCKQQQNSGYSV
NGSFAEYCLADGEYVGVIPEGVDLLEIAPILCAGVTVYKGLKMTEAKTGDWVAISGIGGL
GHVAVQYAKTMGFNVVAIDVDDSKLELAKQLGADVGINALKVDVKEEVLKATGEGCHGVL
VTAVSPKAFEQAVSVVRRGGTMVLNGLPPGKFDLSIFDMVLDGITVRGSIVGTRLDLKEA
LDIAARGKVKAHISVEPLENINDIFERMEQGKIDGRIVIDLKL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtttaatgaaagctgcagtagtcactgcttttaatcaaccgttagagatcaag
gatgtagaaataccgaaagttacttcaggcaaagtattggtgaagatgattgcaacggga
gtctgtcataccgatttacacgctatgcacggtgattggccgatcaaacccagtctccct
ttcattcctggacacgaaggtgtaggtgaggtggtcgaaattggagaaggcattacacac
ttaaaaattggcgatacagtgggtgttccttggttatattcggcatgtggtcattgtgac
cattgttacgccggctgggaaacattatgtaagcaacagcaaaactctggttactctgta
aatggtagttttgcagaatactgtctggccgatggcgaatatgttggagtgattcctgag
ggcgtagatttacttgaaatcgcgccaattttatgtgcaggggtaactgtatataaaggt
ttaaaaatgacagaagccaaaactggtgattgggttgcaatttctggtattggtggctta
ggtcatgttgccgtacagtatgcaaaaacgatgggctttaatgtggttgcaattgatgta
gatgacagcaaattggaacttgccaaacagttaggtgcagatgtgggaatcaatgcactt
aaagttgatgtaaaagaagaggtcctaaaagcgacaggtgaaggttgtcatggggtattg
gtgactgctgtttctcctaaggcttttgaacaggcagtatccgttgtacgacgtggtgga
accatggttttaaacggcttaccaccaggtaaatttgacctttcaatttttgatatggtg
ctggatggaatcaccgtgcgtggttcgattgtaggaactcggctggatctgaaagaagcg
ttggatattgcagcgcgtggaaaagtaaaagcacatattagcgtagaacccctagaaaat
atcaatgatatttttgagcgaatggaacagggtaaaattgatggacgtattgtgattgac
cttaaactctaa

DBGET integrated database retrieval system