KEGG   Acinetobacter sp. ADP1: ACIAD3339Help
Entry
ACIAD3339         CDS       T00185                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ACIAD3339 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD3339 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    ACIAD3339 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACIAD3339 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ACIAD3339 (adhA)
   00626 Naphthalene degradation
    ACIAD3339 (adhA)
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ACIAD3339 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3241694..3242725)
Genome map
AA seq 343 aa AA seqDB search
MGSLMKAAVVTAFNQPLEIKDVEIPKVTSGKVLVKMIATGVCHTDLHAMHGDWPIKPSLP
FIPGHEGVGEVVEIGEGITHLKIGDTVGVPWLYSACGHCDHCYAGWETLCKQQQNSGYSV
NGSFAEYCLADGEYVGVIPEGVDLLEIAPILCAGVTVYKGLKMTEAKTGDWVAISGIGGL
GHVAVQYAKTMGFNVVAIDVDDSKLELAKQLGADVGINALKVDVKEEVLKATGEGCHGVL
VTAVSPKAFEQAVSVVRRGGTMVLNGLPPGKFDLSIFDMVLDGITVRGSIVGTRLDLKEA
LDIAARGKVKAHISVEPLENINDIFERMEQGKIDGRIVIDLKL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtttaatgaaagctgcagtagtcactgcttttaatcaaccgttagagatcaag
gatgtagaaataccgaaagttacttcaggcaaagtattggtgaagatgattgcaacggga
gtctgtcataccgatttacacgctatgcacggtgattggccgatcaaacccagtctccct
ttcattcctggacacgaaggtgtaggtgaggtggtcgaaattggagaaggcattacacac
ttaaaaattggcgatacagtgggtgttccttggttatattcggcatgtggtcattgtgac
cattgttacgccggctgggaaacattatgtaagcaacagcaaaactctggttactctgta
aatggtagttttgcagaatactgtctggccgatggcgaatatgttggagtgattcctgag
ggcgtagatttacttgaaatcgcgccaattttatgtgcaggggtaactgtatataaaggt
ttaaaaatgacagaagccaaaactggtgattgggttgcaatttctggtattggtggctta
ggtcatgttgccgtacagtatgcaaaaacgatgggctttaatgtggttgcaattgatgta
gatgacagcaaattggaacttgccaaacagttaggtgcagatgtgggaatcaatgcactt
aaagttgatgtaaaagaagaggtcctaaaagcgacaggtgaaggttgtcatggggtattg
gtgactgctgtttctcctaaggcttttgaacaggcagtatccgttgtacgacgtggtgga
accatggttttaaacggcttaccaccaggtaaatttgacctttcaatttttgatatggtg
ctggatggaatcaccgtgcgtggttcgattgtaggaactcggctggatctgaaagaagcg
ttggatattgcagcgcgtggaaaagtaaaagcacatattagcgtagaacccctagaaaat
atcaatgatatttttgagcgaatggaacagggtaaaattgatggacgtattgtgattgac
cttaaactctaa

DBGET integrated database retrieval system