KEGG   Acinetobacter sp. ADP1: ACIAD3475Help
Entry
ACIAD3475         CDS       T00185                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00010  Glycolysis / Gluconeogenesis
aci00620  Pyruvate metabolism
aci00640  Propanoate metabolism
aci00680  Methane metabolism
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
aci01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD3475 (acs)
   00620 Pyruvate metabolism
    ACIAD3475 (acs)
   00640 Propanoate metabolism
    ACIAD3475 (acs)
  Energy metabolism
   00680 Methane metabolism
    ACIAD3475 (acs)
Enzymes [BR:aci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ACIAD3475 (acs)
Lipid biosynthesis proteins [BR:aci01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ACIAD3475 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAG70124
UniProt: Q6F741
Position
complement(3400318..3402279)
Genome map
AA seq 653 aa AA seqDB search
MNEIYPVPEEFKKTARTVEADYFTRYQKSIEDPDAFWADEARNVDWIKPFTQVKNSNYDA
EQFKIEWFADGQLNVCANCLDRHLKEHPHKPAIIWEGDHPSRHKIISFKELYEEVCRFAN
VLKKYGISKGDRVVLYMPMVSEAAIAMLACARIGAVHCVVFGGFSPDSLASRIEDCQAKL
VITADAGMRGGKLLPLKDSVDEALKLEGTESIEHVIVVHRTGNPIHFQEGRDLWYHVVIT
EVNEICPPEQMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYATTTFREVFDIKQDDVYW
CTADVGWITGHSYLIYGPLSNGTTTLMFEGIPQYPTWARIGHIVDKHNVTILYTAPTAIR
SMMREGDAFVRESDRSSLRLLGTVGEPINPEAWSWYYNVVGEGRCPVVDTWWQTETGGIL
IAPLPGATALKPGSATRPFFGVQPGLVDGDGHEIEGAAEGNLVIKDSWPGQMRGIWGDPK
RFIEAYFSTFPGRYFTGDGARRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVAHPHV
AEAAVVGMPHEIKGQGICTFVTLQAGVDESEELRKELVQWVRKILGPIATPDALHWAPAL
PKTRSGKIMRRILRKIAANELDSLGDTSTLADPSVVEYLINTVYPEKTQNSTS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaatctatccagtacctgaagagtttaaaaaaacagcccgtaccgtagaagcg
gattattttacccgctatcaaaaatcaatcgaagatccagatgctttttgggcagatgaa
gcccgcaatgtagactggataaaaccatttacccaagtcaaaaacagcaactatgatgca
gagcaattcaaaattgaatggtttgcagatggtcagctcaatgtctgcgcaaattgtctg
gatcgacatttaaaagaacatccgcacaaacccgcaattatctgggaaggtgatcatcct
tcacgacataaaattatttcctttaaagagctatacgaagaagtttgtcggtttgccaat
gtattaaaaaaatatggtatttccaaaggcgaccgtgttgtactttatatgccaatggtg
tctgaagcagcgattgccatgttggcatgcgcgcgaattggtgcggtgcactgtgtggtg
tttggtggcttttcgccagactcattggcaagtcggattgaagactgtcaggccaaactg
gtgattaccgccgatgcaggtatgcgaggaggtaaattacttccactcaaggacagtgta
gatgaagcacttaagcttgaaggaactgagtcgattgagcatgtgattgtggtgcatcgg
acaggtaatccgatccattttcaggaaggacgtgatctctggtatcacgtggtgattact
gaggtgaatgaaatttgcccaccagaacaaatgaatgctgaagatccactatttatcctg
tatacctcaggctcgactggaaagccaaaaggggtgctgcataccacaggcggttatctg
gtctatgccaccacaacattcagagaagtctttgacattaaacaagatgatgtgtactgg
tgtacggctgatgtgggctggattacaggtcatagttatctgatttatggtccactttcc
aatggcacaaccaccctgatgtttgaaggcattccgcaatatccgacatgggcacgaatt
ggacatattgtcgataaacataacgtcacgattctctataccgcaccgactgccattcgt
tccatgatgcgtgaaggagatgcgtttgtacgtgaaagtgaccgtagtagcttgcgctta
ttgggtacagtcggtgagccaatcaatccagaagcctggtcatggtattataacgtggta
ggtgaaggccgttgtcctgtggtcgatacatggtggcaaacagaaacgggcggtatcctg
attgcacctttacctggtgcaacagcattaaaaccaggatcggcgacacgcccatttttt
ggtgttcaaccagggcttgtcgatggcgatggtcatgagattgaaggtgccgcagaagga
aacctcgtgattaaggattcttggccaggtcagatgcgtggtatttggggagatcctaaa
cgctttattgaagcttatttttcaactttccctggtcgttattttactggtgacggtgcg
cgccgcgatgaagatggttattactggattacagggcgtgtcgatgatgttttaaacatt
tcagggcatcgtcttggaacagcagaaattgaaagtgctttggtggcacatccgcatgtg
gctgaggctgccgtggtaggcatgccacatgaaatcaaaggtcaaggcatttgtaccttt
gtgacccttcaggctggtgtggatgaatcggaagagttacgtaaagaattggtacagtgg
gttcgtaagattttagggccgattgcaacgcctgatgcattacattgggcacccgctttg
cctaaaacccgttctggtaaaatcatgcgtcgtatattacgtaaaattgcggccaatgag
cttgatagtttgggggacacctcgactctggccgatccaagtgtggttgagtatctgatt
aacacggtctatccagaaaaaacgcaaaattccacatcatag

DBGET integrated database retrieval system