KEGG   Acinetobacter sp. ADP1: ACIAD3673Help
Entry
ACIAD3673         CDS       T00185                                 

Definition
thiol:disulfide interchange protein (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aci  Acinetobacter sp. ADP1
Brite
Enzymes [BR:aci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ACIAD3673
Secretion system [BR:aci02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ACIAD3673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3584996..3585817)
Genome map
AA seq 273 aa AA seqDB search
MVYFSDVSRGTCRSFLIKNTTQQVMNSSTLGFFDQLCVVMQNMKKQLLMGILVGVASLAH
ANLEQVQQQLKAHYPNVKIENLQKTPMSGIYSGTLDNQIVYLGEDAEHLFVGSMIRLKDQ
RNLTKDLVVQQNSFRWSDLPLQDAIKTVKGNGKRQIAVFSDPHCPYCKQLERELDRLNNV
TIYTFLYPLKSESFIPAQQIWCSPNRSYAWKNLINQNIQPQASSECANPIQRNLALGQRL
KIQGTPTLFFSQGLKVTGVQTSTQIEQILKDVP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtggtttatttttcagatgtttcacgtggaacctgcaggagttttttaataaaaaataca
acacagcaggtgatgaattcttctacactaggtttttttgatcagctttgcgttgttatg
caaaatatgaaaaagcagcttttaatgggtattctggttggagtggccagtcttgcacat
gccaatctcgaacaggttcaacagcaactaaaagcacattatcccaatgtcaaaattgag
aatctgcaaaagacacctatgagcggtatttacagcggcacattggataatcagatcgtt
tatttgggtgaagatgctgaacatctatttgttggttccatgattcgcttgaaagatcag
cgtaatctcaccaaagatttggtggttcagcaaaacagctttcgttggagtgatttgcct
ttacaagacgccattaaaacagtcaaaggtaatggaaaacgacagattgcggtattttcc
gatccacactgcccttactgcaaacaattagaacgtgagttagaccgtctgaataatgtc
accatctatacgtttttatatccactaaaatcagaatcgttcattccagcacagcaaatc
tggtgttcacctaaccgcagttatgcttggaaaaatttaatcaatcaaaacattcagccg
caggccagtagtgaatgtgctaatccaatccagcgcaatctggcacttggacaacgttta
aaaattcagggcacacctacactgttttttagtcaaggtttgaaagtgacaggagtgcaa
acatctacacagattgaacagatcctgaaagatgtaccataa

DBGET integrated database retrieval system