KEGG   Acidovorax sp. NA3: CBP34_10480Help
Entry
CBP34_10480       CDS       T04997                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acin  Acidovorax sp. NA3
Pathway
acin00071  Fatty acid degradation
acin00072  Synthesis and degradation of ketone bodies
acin00280  Valine, leucine and isoleucine degradation
acin00310  Lysine degradation
acin00362  Benzoate degradation
acin00380  Tryptophan metabolism
acin00620  Pyruvate metabolism
acin00630  Glyoxylate and dicarboxylate metabolism
acin00640  Propanoate metabolism
acin00650  Butanoate metabolism
acin00900  Terpenoid backbone biosynthesis
acin01100  Metabolic pathways
acin01110  Biosynthesis of secondary metabolites
acin01120  Microbial metabolism in diverse environments
acin01130  Biosynthesis of antibiotics
acin01200  Carbon metabolism
acin01212  Fatty acid metabolism
acin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acin00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBP34_10480
   00630 Glyoxylate and dicarboxylate metabolism
    CBP34_10480
   00640 Propanoate metabolism
    CBP34_10480
   00650 Butanoate metabolism
    CBP34_10480
  Lipid metabolism
   00071 Fatty acid degradation
    CBP34_10480
   00072 Synthesis and degradation of ketone bodies
    CBP34_10480
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBP34_10480
   00310 Lysine degradation
    CBP34_10480
   00380 Tryptophan metabolism
    CBP34_10480
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBP34_10480
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBP34_10480
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CBP34_10480
Enzymes [BR:acin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBP34_10480
Exosome [BR:acin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBP34_10480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ART51998
UniProt: A0A240U3Q0
Position
1:2264040..2265224
Genome map
AA seq 394 aa AA seqDB search
MTREVVVVSAVRTAIGTFGGSLKDVPPTELGALVVRESLARANVEGKDVGHVVFGHVVNT
EPKDMYLSRVAAINGGCGEGTPAFNVNRLCGSGLQAIVNASQSILLGDTDVAIGAGAENM
SRVPFASLNMRWGARMGDTKMVDMMIGALHDPFHNIHMGVTAENIAAKWGITREDQDKLA
VESHNRAERAIQAGVFKDQIVPVTLKSKKGDVQYATDEHFRPGATMEDLAKLKPAFLKEN
GTVTAGNASGINDAAAAVVLMEAGAAKARGAKPLARLVAYAHAGVDPKYMGIGPVPATQL
ALKKAGLTVNDLDVIEANEAFAAQACAVTRDLGLDPAKVNPNGSGISLGHPIGATGALIT
VKAIHELQRIQGRYALVTMCIGGGQGIAAIFERI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgaagtcgtcgtcgtcagcgcagtgcgcaccgccatcggcacctttggtggc
agcctgaaagatgtgccgcccaccgaactgggcgcgctcgtcgtgcgcgaatcgctcgcg
cgtgccaacgtggaaggcaaagatgtgggccatgtggtgttcggccatgtggtcaacacc
gagcccaaggacatgtacctgtcgcgcgtggctgccatcaacggcggctgcggcgaaggc
acgcctgccttcaacgtcaaccgcctgtgcggctcgggcctgcaggccatcgtgaacgcc
agccagtccattctgctgggcgacaccgacgtggccattggcgccggtgccgagaacatg
agccgcgtgccctttgccagcctgaacatgcgctggggcgcccgcatgggtgacaccaag
atggtggacatgatgatcggcgcgctgcacgacccctttcacaacatccacatgggtgtg
acggccgagaacatcgcagccaagtggggcatcacccgcgaagaccaggacaagctggcc
gtggaaagccacaaccgtgccgagcgcgccatccaggccggtgtgttcaaggaccagatc
gtgcccgtgaccctgaaaagcaaaaaaggtgacgtgcaatacgccaccgacgagcatttc
cgccccggcgccaccatggaagacctggccaagctcaagcccgcctttctcaaggaaaac
ggcacggtgaccgccggcaatgcctcgggcatcaacgacgccgccgcggccgtggtactg
atggaagccggtgccgccaaggcgcgcggcgccaagcccttggcccgcctggtggcctac
gcccacgcaggcgtggaccccaagtacatgggtatcggccccgtgcccgccacgcaactg
gccctgaagaaagccggcctgacggtgaacgaccttgatgtgatcgaggccaacgaggcc
tttgccgcacaggcctgcgccgtcacgcgcgacctggggctggacccggccaaggtcaac
cccaatggttcgggcatttcactgggccaccccatcggtgccaccggtgcgctgatcacc
gtgaaagccatccacgagctgcagcgcatccagggccgctacgcgctggtgaccatgtgc
attggcggtggccagggcattgccgccatttttgagcgcatctga

DBGET integrated database retrieval system