KEGG   Aeropyrum camini: ACAM_1038Help
Entry
ACAM_1038         CDS       T02858                                 

Definition
aldolase class II protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
acj  Aeropyrum camini
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ACAM_1038
Enzymes [BR:acj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ACAM_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997378..998028
Genome map
AA seq 216 aa AA seqDB search
MLQTGITLLRRSRGRVRVFYTPRGPIEKSVMSDVAEVLRTLYERGLVQAMGGNVSVLHNG
LVYISPTRLFRGGLRWLDVAVMTMDGRVVRGRPSSEWRMHIAIYRRLKGVTAVVHAHPPA
LLAADAAGLRLEASLLMEAQATVGCIASVPRVKPGTWELADAVATALEASGCRAAVLRNH
GVVAVGGSVWEALNMAEAVEDLARISLGIGGRVVGG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaaaccggtataaccctcctcaggagaagccgggggcgtgtaagagtgttctac
actcctagggggcctatcgagaagagcgtcatgtcggatgttgccgaggtcctcagaacc
ctctatgagaggggtctggtccaggctatggggggcaacgtctccgtcctccataacggc
ctcgtctacatctcaccaacgagactctttagaggcgggctccgctggcttgacgtggcc
gtgatgaccatggacggtagggtagttagggggaggcctagtagtgagtggaggatgcac
atagccatctacaggcggctgaagggtgtcaccgctgtggtacacgcacacccgcctgcc
ctactagccgcggacgccgccgggctgaggctcgaggccagcctactcatggaggctcaa
gcaactgtaggctgcatcgcctcagtaccgcgtgtcaagcccggcacctgggagctggcg
gacgctgtggccacggccctcgaagcatcgggctgcagagctgccgtgctcaggaatcat
ggtgttgttgccgttggggggagcgtctgggaagccctcaacatggccgaggctgttgag
gacctcgccagaataagcctgggtatcggggggagggttgtcggtggctga

DBGET integrated database retrieval system